A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11094 |
| Swiss-prot Accession number | P68259 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
| Source organism | Gallus gallus (Chicken) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1 and GLP-2. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide (By similarity). |
| Function | GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis |
| Protein Length | 206 Amino acids |
| Molecular weight | 23876 |
| References | 1 PubMed abstract 2338135 2 PubMed abstract 7776976 3 PubMed abstract 1194290 4 PubMed abstract 2828209 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 2 |
| Mature Hormone Sequence | HADGTFTSDINKILDDMAAKEFLKWLINTKVTQ |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (166-198) |
| Receptor | N/A |
| Gene ID | 396196 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |