A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11099 |
| Swiss-prot Accession number | P09566 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide] (Fragment). |
| Source organism | Lepisosteus spatula (Alligator gar) (Atractosteus spatula) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Semionotiformes; Lepisosteidae;Lepisosteus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. |
| Protein Length | 78 Amino acids |
| Molecular weight | 9000 |
| References | 1 PubMed abstract 3282974 2 PubMed abstract 3311873 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-36 |
| Mature Hormone Sequence | HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGIT |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |