A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11113 |
| Swiss-prot Accession number | P01274 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain |
| Post translational modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity). |
| Function | Oxyntomodulin significantly reduces food intake |
| Protein Length | 180 Amino acids |
| Molecular weight | 21029 |
| References | 1 Siggers R.H., Goldade B.G., Laarveld B., Van Kessel A.G.; "Cloning of porcine proglucagon."; Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 6894800 3 PubMed abstract 7045833 4 Bromer W.W., Sinn L.G., Behrens O.K.; "The amino acid sequence of glucagon. V. Location of amide groups,acid degradation studies and summary of sequential evidence."; J. Am. Chem. Soc. 79:2807-2810(1957). 5 PubMed abstract 2753890 6 PubMed abstract 3379036 7 PubMed abstract 3530719 8 PubMed abstract 12554744 9 PubMed abstract 12626323 10 PubMed abstract 10322410 11 PubMed abstract 10605628 12 PubMed abstract 171582 |
| Domain Name | Hormone_2 |
| Hormone Name | Oxyntomodulin |
| Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Position of mature hormone in Pre-Hormone protein | 37 Residues from position (53-89) |
| Receptor | N/A |
| Gene ID | 397595 |
| PDB ID | 1GCN |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |