A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11119 |
| Swiss-prot Accession number | P15438 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments). |
| Source organism | Rana catesbeiana (Bull frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 103 Amino acids |
| Molecular weight | 11721 |
| References | 1 PubMed abstract 3260236 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-36 |
| Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |