A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11124 |
| Swiss-prot Accession number | P09687 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glucagon-29; Glucagon-33; Glucagon-likepeptide] (Fragments). |
| Source organism | Scyliorhinus canicula (Spotted dogfish) (Spotted catshark) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 62 Amino acids |
| Molecular weight | 7270 |
| References | 1 PubMed abstract 8015974 2 PubMed abstract 3569517 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-33 |
| Mature Hormone Sequence | HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNG |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |