A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11145 |
| Swiss-prot Accession number | P21779 (Sequence in FASTA format) |
| Description | Somatostatin-37 [Contains: Somatostatin-34; Somatostatin-14]. |
| Source organism | Petromyzon marinus (Sea lamprey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatostatin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Somatostatin inhibits the release of somatotropin |
| Protein Length | 37 Amino acids |
| Molecular weight | 4039 |
| References | 1 PubMed abstract 2902094 |
| Domain Name | Somatostatin |
| Hormone Name | Somatostatin-34 |
| Mature Hormone Sequence | AAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (4-37) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |