A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11170 |
| Swiss-prot Accession number | P23362 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12665 |
| References | 1 PubMed abstract 2174979 2 "DNA sequences of macaque genes expressed in brain or testis and itsevolutionary implications."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases. |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin |
| Mature Hormone Sequence | QPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
| Position of mature hormone in Pre-Hormone protein | 95 Residues from position (21-115) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |