A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11184 |
| Swiss-prot Accession number | P01356 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Sus scrofa (Pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Synthesized in both cerebral cortex and duodenal mucosa |
| Post translational modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33, CCK39, and CCK58 as well as CCK-octapeptide and the CCK- desoctapeptides. Distribution differences are due to tissue- specific post-translational processing events. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion. |
| Protein Length | 114 Amino acids |
| Molecular weight | 12526 |
| References | 1 PubMed abstract 6205394 2 Mutt V., Jorpes J.E.; Submitted (AUG-1970) to the PIR data bank. 3 PubMed abstract 5410106 4 PubMed abstract 8443599 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-58 |
| Mature Hormone Sequence | AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 58 Residues from position (45-102) |
| Receptor | N/A |
| Gene ID | 397468 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |