A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11195 |
| Swiss-prot Accession number | P80345 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 40 (CCK40); Cholecystokinin 33 (CCK33);Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
| Source organism | Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Expressed in brain, duodenum and small intestine |
| Post translational modification | N/A |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Protein Length | 130 Amino acids |
| Molecular weight | 14603 |
| References | 1 PubMed abstract 10561540 2 PubMed abstract 7925386 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin |
| Mature Hormone Sequence | QQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS |
| Position of mature hormone in Pre-Hormone protein | 110 Residues from position (21-130) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |