A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11197 |
| Swiss-prot Accession number | P09681 (Sequence in FASTA format) |
| Description | Gastric inhibitory polypeptide precursor (GIP) (Glucose-dependentinsulinotropic polypeptide). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion |
| Protein Length | 153 Amino acids |
| Molecular weight | 17108 |
| References | 1 PubMed abstract 2890159 2 PubMed abstract 2739653 3 PubMed abstract 15489334 4 PubMed abstract 6745415 5 PubMed abstract 15522230 |
| Domain Name | Hormone_2 |
| Hormone Name | Gastric inhibitory polypeptide |
| Mature Hormone Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Position of mature hormone in Pre-Hormone protein | 42 Residues from position (52-93) |
| Receptor | N/A |
| Gene ID | 2695 |
| PDB ID | 1T5Q 2B4N |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |