A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11210 |
| Swiss-prot Accession number | P01347 (Sequence in FASTA format) |
| Description | Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain]. |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
| Protein Length | 186 Amino acids |
| Molecular weight | 20489 |
| References | 1 PubMed abstract 7231533 2 PubMed abstract 14659888 3 PubMed abstract 7004862 |
| Domain Name | Insulin |
| Hormone Name | Relaxin B chain |
| Mature Hormone Sequence | RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL |
| Position of mature hormone in Pre-Hormone protein | 35 Residues from position (23-57) |
| Receptor | N/A |
| Gene ID | 25616 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |