A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11225 |
| Swiss-prot Accession number | P11953 (Sequence in FASTA format) |
| Description | Relaxin [Contains: Relaxin B chain; Relaxin A chain]. |
| Source organism | Squalus acanthias (Spiny dogfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | The function of relaxin in an oviparous species is not yet known |
| Protein Length | 54 Amino acids |
| Molecular weight | 5910 |
| References | 1 PubMed abstract 3780747 |
| Domain Name | Insulin |
| Hormone Name | Relaxin B chain |
| Mature Hormone Sequence | QSFKNAEPGIKLCGREFIRAVIYTCGGSRW |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |