A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11229 |
| Swiss-prot Accession number | O42143 (Sequence in FASTA format) |
| Description | Glucagon-1 precursor (Glucagon I) [Contains: Glucagon; Glucagon-likepeptide 1A (GLP-1A); Glucagon-like peptide 1B (GLP-1B); Glucagon-likepeptide 1C (GLP-1C); Glucagon-like peptide 2 (GLP-2)]. |
| Source organism | Xenopus laevis (African clawed frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
| Protein Length | 266 Amino acids |
| Molecular weight | 30951 |
| References | 1 PubMed abstract 9223287 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 1A |
| Mature Hormone Sequence | HAEGTFTSDVTQQLDEKAAKEFIDWLINGGPSKEIIS |
| Position of mature hormone in Pre-Hormone protein | 37 Residues from position (97-133) |
| Receptor | Q8UVY5
Detail in HMRbase |
| Gene ID | 373686 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |