A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11242 |
| Swiss-prot Accession number | P01143 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 187 Amino acids |
| Molecular weight | 20680 |
| References | 1 PubMed abstract 3876950 2 PubMed abstract 3274895 3 PubMed abstract 6603620 |
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (145-185) |
| Receptor | P35353 Detail in HMRbase P47866 Detail in HMRbase |
| Gene ID | 81648 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |