A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11263 |
| Swiss-prot Accession number | P01190 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 265 Amino acids |
| Molecular weight | 29260 |
| References | 1 PubMed abstract 221818 2 PubMed abstract 6249166 3 PubMed abstract 6263630 4 Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5 Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6 PubMed abstract 216007 7 PubMed abstract 7274457 8 PubMed abstract 13642798 9 Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10 PubMed abstract 4344689 11 Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12 Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13 PubMed abstract 13348631 14 PubMed abstract 1065904 15 PubMed abstract 4030947 16 PubMed abstract 2266117 17 PubMed abstract 221818 18 PubMed abstract 6249166 19 PubMed abstract 6263630 20 Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21 Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22 PubMed abstract 216007 23 PubMed abstract 7274457 24 PubMed abstract 13642798 25 Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26 PubMed abstract 4344689 27 Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28 Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29 PubMed abstract 13348631 30 PubMed abstract 1065904 31 PubMed abstract 4030947 32 PubMed abstract 2266117 |
| Domain Name | ACTH_domain NPP Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKD |
| Position of mature hormone in Pre-Hormone protein | 60 Residues from position (173-232) |
| Receptor | P47798
Detail in HMRbase |
| Gene ID | 281416 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |