A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11295 |
| Swiss-prot Accession number | P01201 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropinbeta (Beta-MSH); Beta-endorphin; Met-enkephalin]. |
| Source organism | Macaca nemestrina (Pig-tailed macaque) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
| Protein Length | 264 Amino acids |
| Molecular weight | 29172 |
| References | 1 PubMed abstract 3229286 2 PubMed abstract 13760276 3 PubMed abstract 3229286 4 PubMed abstract 13760276 |
| Domain Name | ACTH_domain NPP Op_neuropeptide |
| Hormone Name | Lipotropin gamma (Gamma-LPH) |
| Mature Hormone Sequence | ELTGQRPRAGDGPDGPADDGAGPRADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD |
| Position of mature hormone in Pre-Hormone protein | 56 Residues from position (176-231) |
| Receptor | Q864J8
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |