A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11306 |
| Swiss-prot Accession number | P01223 (Sequence in FASTA format) |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Indispensable for the control of thyroid structure and metabolism |
| Protein Length | 138 Amino acids |
| Molecular weight | 15624 |
| References | 1 PubMed abstract 6325416 2 PubMed abstract 5101174 3 PubMed abstract 5101173 4 PubMed abstract 8670056 |
| Domain Name | Cys_knot |
| Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Mature Hormone Sequence | FCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY |
| Position of mature hormone in Pre-Hormone protein | 112 Residues from position (21-132) |
| Receptor | Q27987
Detail in HMRbase |
| Gene ID | 281552 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |