A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11312 |
| Swiss-prot Accession number | P01231 (Sequence in FASTA format) |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain) (Interstitial cell-stimulating hormone) [Contains: LH beta-1; LH beta-2; LH beta-3]. |
| Source organism | Ovis aries (Sheep) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The LH alpha 3/LH beta 3 heterodimer was shown to have potent renotropic and weak gonadotropic activity |
| Protein Length | 141 Amino acids |
| Molecular weight | 15184 |
| References | 1 PubMed abstract 8349025 2 PubMed abstract 2336396 3 PubMed abstract 4556309 4 PubMed abstract 4575435 5 PubMed abstract 2456202 6 PubMed abstract 1201911 7 PubMed abstract 2209620 |
| Domain Name | Cys_knot |
| Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Mature Hormone Sequence | SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCLSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL |
| Position of mature hormone in Pre-Hormone protein | 121 Residues from position (21-141) |
| Receptor | Q28585
Detail in HMRbase |
| Gene ID | 443395 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |