A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11314 |
| Swiss-prot Accession number | P01236 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Protein Length | 227 Amino acids |
| Molecular weight | 25876 |
| References | 1 PubMed abstract 6260780 2 PubMed abstract 6325171 3 PubMed abstract 2050267 4 PubMed abstract 15489334 5 PubMed abstract 6146607 6 PubMed abstract 9266104 7 PubMed abstract 925136 8 PubMed abstract 1126929 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
| Position of mature hormone in Pre-Hormone protein | 199 Residues from position (29-227) |
| Receptor | P16471
Detail in HMRbase |
| Gene ID | 5617 |
| PDB ID | 1N9D 1RW5 2Q98 3D48 |
| Drugpedia | wiki |
| Comments |