A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11321 |
| Swiss-prot Accession number | P01246 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
| Protein Length | 217 Amino acids |
| Molecular weight | 24558 |
| References | 1 PubMed abstract 6893197 2 PubMed abstract 6296767 3 PubMed abstract 6303731 4 PubMed abstract 6357899 5 Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6 Mauro S.M.Z., Ferro M.I.T., Macari M., Ferro J.A.; "The complete sequence of a cDNA encoding the bovine growth hormone."; Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases. 7 Javadmanesh A., Nassiry M., Eftekhari Shahrudi F., Basami M.; "Cloning the cDNA of bovine growth hormone gene in E. coli."; Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 4584625 9 PubMed abstract 4580883 10 PubMed abstract 3899556 11 PubMed abstract 4856718 12 PubMed abstract 5579941 13 PubMed abstract 1123321 14 PubMed abstract 2021631 |
| Domain Name | Hormone_1 |
| Hormone Name | Growth hormone (Somatotropin) (GH) |
| Mature Hormone Sequence | AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
| Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
| Receptor | O46600
Detail in HMRbase |
| Gene ID | 280804 |
| PDB ID | 1BST |
| Drugpedia | wiki |
| Comments |