A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11334 |
| Swiss-prot Accession number | P01286 (Sequence in FASTA format) |
| Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH) (Somatocrinin) (Somatorelin)(Sermorelin). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Protein Length | 108 Amino acids |
| Molecular weight | 12447 |
| References | 1 PubMed abstract 6192430 2 PubMed abstract 3918305 3 PubMed abstract 11780052 4 PubMed abstract 15489334 5 PubMed abstract 6415488 6 PubMed abstract 6812220 7 PubMed abstract 2854259 8 PubMed abstract 3029387 |
| Domain Name | Hormone_2 |
| Hormone Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
| Mature Hormone Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Position of mature hormone in Pre-Hormone protein | 44 Residues from position (32-75) |
| Receptor | Q02643
Detail in HMRbase |
| Gene ID | 2691 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |