A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11338 |
| Swiss-prot Accession number | P01322 (Sequence in FASTA format) |
| Description | Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain]. |
| Source organism | Rattus norvegicus (Rat) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 110 Amino acids |
| Molecular weight | 12421 |
| References | 1 PubMed abstract 498283 2 PubMed abstract 498284 3 PubMed abstract 6249167 4 PubMed abstract 4311938 5 PubMed abstract 4640931 6 PubMed abstract 4554104 |
| Domain Name | Insulin |
| Hormone Name | Insulin-1 B chain |
| Mature Hormone Sequence | FVKQHLCGPHLVEALYLVCGERGFFYTPKS |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
| Receptor | P15127
Detail in HMRbase |
| Gene ID | 24505 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |