A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11342 |
| Swiss-prot Accession number | P01326 (Sequence in FASTA format) |
| Description | Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain]. |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 110 Amino acids |
| Molecular weight | 12364 |
| References | 1 PubMed abstract 3104603 2 PubMed abstract 2397023 3 PubMed abstract 5063718 |
| Domain Name | Insulin |
| Hormone Name | Insulin-2 B chain |
| Mature Hormone Sequence | FVKQHLCGSHLVEALYLVCGERGFFYTPMS |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
| Receptor | P15208
Detail in HMRbase |
| Gene ID | 16334 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |