A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11368 |
| Swiss-prot Accession number | P04768 (Sequence in FASTA format) |
| Description | Prolactin-2C3 precursor (Proliferin-2) (Mitogen-regulated protein 2). |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation |
| Protein Length | 224 Amino acids |
| Molecular weight | 25312 |
| References | 1 PubMed abstract 3859868 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin-2C3 |
| Mature Hormone Sequence | FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFNEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYAALLKSGAMISDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC |
| Position of mature hormone in Pre-Hormone protein | 195 Residues from position (30-224) |
| Receptor | Q08501
Detail in HMRbase |
| Gene ID | 18812 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |