| HMRbase accession number | 11377 |
| Swiss-prot Accession number | P06850 (Sequence in FASTA format) |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Protein Length | 196 Amino acids |
| Molecular weight | 21422 |
| References | 1 PubMed abstract 6605851
2 PubMed abstract 2783917
3 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
4 PubMed abstract 15489334
5 PubMed abstract 3262120
6 PubMed abstract 8386360
|
| Domain Name | CRF |
| Hormone Name | Corticoliberin |
| Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (154-194) |
| Receptor | P34998 Detail in HMRbase
Q13324
Detail in HMRbase
|
| Gene ID | 1392 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | |
A database of hormones and their receptors