A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11404 |
| Swiss-prot Accession number | P12707 (Sequence in FASTA format) |
| Description | Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain]. |
| Source organism | Xenopus laevis (African clawed frog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 106 Amino acids |
| Molecular weight | 12207 |
| References | 1 PubMed abstract 2722842 2 PubMed abstract 2661211 |
| Domain Name | Insulin |
| Hormone Name | Insulin-2 B chain |
| Mature Hormone Sequence | LANQHLCGSHLVEALYLVCGDRGFFYYPKI |
| Position of mature hormone in Pre-Hormone protein | 30 Residues from position (24-53) |
| Receptor | Q9PVZ4
Detail in HMRbase |
| Gene ID | 378695 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |