A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11412 |
| Swiss-prot Accession number | P16043 (Sequence in FASTA format) |
| Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Protein Length | 103 Amino acids |
| Molecular weight | 12064 |
| References | 1 PubMed abstract 2514346 2 PubMed abstract 2481813 3 PubMed abstract 16141072 4 PubMed abstract 15489334 |
| Domain Name | Hormone_2 |
| Hormone Name | Somatoliberin |
| Mature Hormone Sequence | HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
| Position of mature hormone in Pre-Hormone protein | 42 Residues from position (31-72) |
| Receptor | P32082
Detail in HMRbase |
| Gene ID | 14601 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |