A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11421 |
| Swiss-prot Accession number | P19402 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Cavia porcellus (Guinea pig) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Beta-endorphin is an endogenous opiate |
| Protein Length | 256 Amino acids |
| Molecular weight | 28264 |
| References | 1 PubMed abstract 1662166 2 PubMed abstract 2830360 3 PubMed abstract 1662166 4 PubMed abstract 2830360 |
| Domain Name | ACTH_domain NPP Op_neuropeptide |
| Hormone Name | Beta-endorphin |
| Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (226-256) |
| Receptor | Q9Z1S9
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |