A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11427 |
| Swiss-prot Accession number | P21819 (Sequence in FASTA format) |
| Description | Diuretic hormone 1 precursor (DH-1) (Diuretic peptide 1) (DP-1) (Mas-DH). |
| Source organism | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Regulation of fluid secretion |
| Protein Length | 138 Amino acids |
| Molecular weight | 15297 |
| References | 1 PubMed abstract 1279702 2 PubMed abstract 16594029 |
| Domain Name | CRF |
| Hormone Name | Diuretic hormone 1 |
| Mature Hormone Sequence | RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI |
| Position of mature hormone in Pre-Hormone protein | 41 Residues from position (81-121) |
| Receptor | P35464
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |