A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11448 |
| Swiss-prot Accession number | P41520 (Sequence in FASTA format) |
| Description | Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Source organism | Bos taurus (Bovine) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | N/A |
| Post translational modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion |
| Protein Length | 115 Amino acids |
| Molecular weight | 12835 |
| References | 1 Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2217909 3 PubMed abstract 4011954 |
| Domain Name | Gastrin |
| Hormone Name | Cholecystokinin-39 |
| Mature Hormone Sequence | YIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (65-103) |
| Receptor | P79266
Detail in HMRbase |
| Gene ID | 617510 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |