A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11499 |
| Swiss-prot Accession number | P79695 (Sequence in FASTA format) |
| Description | Glucagon precursor [Contains: Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide]. |
| Source organism | Carassius auratus (Goldfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 121 Amino acids |
| Molecular weight | 13527 |
| References | 1 DOI=10.1023/A:1007793705131; Yuen T.T.H., Mok P.Y., Chow B.K.C.; "Molecular cloning of a cDNA encoding proglucagon from goldfish,Carassius auratus."; Fish Physiol. Biochem. 17:223-230(1997).
|
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide |
| Mature Hormone Sequence | HAEGTYTSDISSFLRDQAAQNFVAWLKSGQPKQE |
| Position of mature hormone in Pre-Hormone protein | 34 Residues from position (88-121) |
| Receptor | Q5EFJ9
Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |