A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11505 |
| Swiss-prot Accession number | Q812B2 (Sequence in FASTA format) |
| Description | Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta). |
| Source organism | Mus musculus (Mouse) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | Expressed in the anterior lobe of pituitary |
| Post translational modification | N/A |
| Function | Stimulates the thyroid. Binds and activates THSR, leading to increased cAMP production |
| Protein Length | 130 Amino acids |
| Molecular weight | 14249 |
| References | 1 Feldhaus A., Holloway J.L., O'Hogan S.L., Tackett M., Taft D.,Thayer E.C., Webster P.; "A novel glycoprotein hormone beta subunit."; Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 16141072 3 PubMed abstract 16210345 |
| Domain Name | Cys_knot |
| Hormone Name | Glycoprotein hormone beta-5 |
| Mature Hormone Sequence | SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI |
| Position of mature hormone in Pre-Hormone protein | 106 Residues from position (25-130) |
| Receptor | P47750
Detail in HMRbase |
| Gene ID | 217674 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |