A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10058 |
| Swiss-prot Accession number | Q4FCM6 (Sequence in FASTA format) |
| Description | Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone). |
| Source organism | Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Contains 1 CTCK (C-terminal cystine knot-like) domain. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading |
| Protein Length | 156 Amino acids |
| Molecular weight | 17659 |
| References | 1 Dewey E.M., Honegger H.-W.; "Identification of the Manduca sexta burs cDNA using RACE PCR."; Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
|
| Domain Name | N/A |
| Hormone Name | Bursicon |
| Mature Hormone Sequence | QEVQLPPGQECQMTPVIHILKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQEAGEREATVVLYCPDAKNEERRFRKVSTKAPLECMCRPCGSIEESAIIPQEVAGYAEEGPLYNHFRKSF |
| Position of mature hormone in Pre-Hormone protein | 130 Residues from position (27-156) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10059 |
| Swiss-prot Accession number | Q566B1 (Sequence in FASTA format) |
| Description | Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone). |
| Source organism | Bombyx mori (Silk moth) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Contains 1 CTCK (C-terminal cystine knot-like) domain. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading |
| Protein Length | 160 Amino acids |
| Molecular weight | 17901 |
| References | 1 PubMed abstract 15141943 2 PubMed abstract 15811337 |
| Domain Name | N/A |
| Hormone Name | Bursicon |
| Mature Hormone Sequence | FPVTGHEVQLPPGTKFFCQECQMTAVIHVLKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQESGEREATVVLFCPDAQNEEKRFRKVSTKAPLQCMCRPCGSIEESSIIPQEVAGYSEEGPLYNHFRKSL |
| Position of mature hormone in Pre-Hormone protein | 140 Residues from position (21-160) |
| Receptor | N/A |
| Gene ID | 100049169 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10083 |
| Swiss-prot Accession number | Q9VD83 (Sequence in FASTA format) |
| Description | Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone). |
| Source organism | Drosophila melanogaster (Fruit fly) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila. |
| Subcellular location | Secreted protein |
| Developmental Stage | Expression is low in larval stages and increases before ecdysis; consistent with role in postecdysial cuticle changes. |
| Similarity | Contains 1 CTCK (C-terminal cystine knot-like) domain. |
| Tissue Specificity | Expressed in one to two pairs of neurons in each of the thoracic and abdominal neuromeres of the larval CNS. Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with pburs in four bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system |
| Post translational modification | N/A |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk |
| Protein Length | 173 Amino acids |
| Molecular weight | 19223 |
| References | 1 PubMed abstract 15242619 2 PubMed abstract 15811337 3 PubMed abstract 16951084 4 PubMed abstract 10731132 5 PubMed abstract 12537572 6 PubMed abstract 15703293 |
| Domain Name | N/A |
| Hormone Name | Bursicon |
| Mature Hormone Sequence | QPDSSVAATDNDITHLGDDCQVTPVIHVLQYPGCVPKPIPSFACVGRCASYIQVSGSKIWQMERSCMCCQESGEREAAVSLFCPKVKPGERKFKKVLTKAPLECMCRPCTSIEESGIIPQEIAGYSDEGPLNNHFRRIALQ |
| Position of mature hormone in Pre-Hormone protein | 141 Residues from position (33-173) |
| Receptor | N/A |
| Gene ID | 42560 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10510 |
| Swiss-prot Accession number | Q66Q82 (Sequence in FASTA format) |
| Description | Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone). |
| Source organism | Anopheles gambiae (African malaria mosquito) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Culicidae;Anophelinae; Anopheles. |
| Subcellular location | Secreted protein (By similarity) |
| Developmental Stage | N/A |
| Similarity | Contains 1 CTCK (C-terminal cystine knot-like) domain. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading |
| Protein Length | 163 Amino acids |
| Molecular weight | 18067 |
| References | 1 Robertson H.M., Honegger W.; "Anopheles gambiae bursicon gene is transspliced."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 12364791 |
| Domain Name | N/A |
| Hormone Name | Bursicon |
| Mature Hormone Sequence | QKDSEDGGSHYSSDDCQVTPVIHVLQYPGCVPKPIPSFACIGRCASYIQVSGSKIWQMERSCMCCQESGEREASVSLFCPKAKNGEKKFRKVSTKAPLECMCRPCTGIEDANVIPQELTSFADEGTLTGYFQKSHYKSIE |
| Position of mature hormone in Pre-Hormone protein | 140 Residues from position (24-163) |
| Receptor | N/A |
| Gene ID | 5667449 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |