A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10225 |
Swiss-prot Accession number | Q8HXS1 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Ailuropoda melanoleuca (Giant panda) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae;Ailuropoda. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 26236 |
References | 1 PubMed abstract 15493147 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPTGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10226 |
Swiss-prot Accession number | Q28318 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Capra hircus (Goat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 25774 |
References | 1 PubMed abstract 7969789 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGYITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMILGQVIPGAKETEPYPVWSGLPSLQTKDEEARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10227 |
Swiss-prot Accession number | P87495 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23288 |
References | 1 PubMed abstract 8652671 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTIDSKTKELQDNINSLGAGLEHVFNKMDSTSDNLSSLPFDINSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10228 |
Swiss-prot Accession number | Q3Y4G6 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Isoodon macrourus (Short-nosed bandicoot) (Northern brown bandicoot) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Peramelemorphia; Peramelidae; Isoodon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 228 Amino acids |
Molecular weight | 25981 |
References | 1 Veitch C., Kusters D.H., Gemmell R.T., Curlewis J.D.; "Cloning and sequence analysis of a pituitary prolactin cDNA from theNorthern brown bandicoot (Isoodon macrourus)."; Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGSVNCQVSLSDLFDRAVMLSHYIHSLSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKGQAQQIHHEALLNLVLRVLRSWNEPLYHLVTEVRSMQEAPHTILLKAMEIEEQNKKLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10229 |
Swiss-prot Accession number | Q9QZL1 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Microtus montebelli (Japanese grass vole) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Arvicolinae; Microtus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 225 Amino acids |
Molecular weight | 25720 |
References | 1 Ohboshi S., Asami W., Kaneko M., Yoshida S., Yoshida T., Tomogane H.; "Sequencing of prolactin cDNA of Japanese field vole."; Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICHSGNCQMTLQELFDRVIMLSHYVYMMSADMFIEFEKRYAQDHEFIAKAINDCPTSSLATPEDKEEAQQVPPEVLLNLILSLVHSWNGPLFQLVTEVDGIHEASDAIISRAKEIGEQNKRLLEGIEKILGQAYPEAKGNEVYSVWSQFPSLQGIDEESRDLALYNKIRCLRRDSHKVDNYLKLLRCRIVHNNNC |
Position of mature hormone in Pre-Hormone protein | 197 Residues from position (29-225) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10230 |
Swiss-prot Accession number | Q9YGV6 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Paralichthys olivaceus (Japanese flounder) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Paralichthyidae; Paralichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 211 Amino acids |
Molecular weight | 23340 |
References | 1 Kim Y.T., Lee S.Y.; "Flounder prolactin."; Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VPINDLLDRASQRSDQLHSLSTTLSQELDSHFPPIGRVIMPRPSMCHTSALQTPNDKTQALQVSESELLSLARSLLQAWADPLSALSSSAFSLPHPAQSSIFNKVREMQEHSKNLGDGLDILSGKMGEAAQALSSLPFRGNDVGQDRISKLINFHFLLSCFRRDSHKIDSFLKVLRCRAANTQPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (25-211) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10324 |
Swiss-prot Accession number | Q28632 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Oryctolagus cuniculus (Rabbit) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 227 Amino acids |
Molecular weight | 25990 |
References | 1 PubMed abstract 8672230 2 PubMed abstract 9094747 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (29-227) |
Receptor | P14787
Detail in HMRbase |
Gene ID | 100009394 |
PDB ID | 1AN3 |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10330 |
Swiss-prot Accession number | Q6UC74 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Cervus elaphus (Red deer) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Cervidae; Cervinae; Cervus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 25794 |
References | 1 PubMed abstract 12742553 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGAGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDGILSRAIEIEEENKRLLEGMEMIFGQVLPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q28235
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11005 |
Swiss-prot Accession number | P33096 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Anguilla anguilla (European freshwater eel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 209 Amino acids |
Molecular weight | 23115 |
References | 1 PubMed abstract 7926267 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLGDMLERASQLSDKLHSLSTSLTNDLDTHFPPMGKILMPRPSMCHTASLQTPHDKDQALRVPESELLSIARALLLSWNDPLLLLASEAPTLSHPQNGAIYSKTRELQDQSNSLSSGLDRLIHKIGSSSKALSPLPLQGGDLGSDKNSRLINFYFLLSCFRRDSHKIDNFLKLLRCRAAKQDRC |
Position of mature hormone in Pre-Hormone protein | 185 Residues from position (25-209) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11006 |
Swiss-prot Accession number | Q7ZZV3 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Anguilla japonica (Japanese eel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 209 Amino acids |
Molecular weight | 23155 |
References | 1 Han Y.-S., Yu J.Y.-L., Liao I.-C., Tzeng W.-N.; "Salinity preference of the silvering Japanese eel Anguilla japonica:evidences from the pituitary prolactin mRNA levels and otolithstrontium/calcium ratios."; Mar. Ecol. Prog. Ser. 259:253-261(2003).
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLGDMLERASQLSDKLHSLSTSLTNDLDTHFPPMGKILMPRPSMCHTASLQTPHDKDQALRVPESELLSLARALLLSWNDPLLLLTSEAPTLSHPQNGVIYSKTRELQDQSNSLSSGLDRLIHKIGSSSKSLSPLPFQGGDLGSDKNSRLINFYFLLSCFRRDSHKIDNFLKLLRCRAAKQDRC |
Position of mature hormone in Pre-Hormone protein | 185 Residues from position (25-209) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11007 |
Swiss-prot Accession number | P33089 (Sequence in FASTA format) |
Description | Prolactin (PRL). |
Source organism | Balaenoptera borealis (Sei whale) (Pollack whale) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 199 Amino acids |
Molecular weight | 22812 |
References | 1 PubMed abstract 4052510 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAIDSCHTSSLQTPEDKEQAQQIHHEVLVSLILGVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIQIEEENKRLLEGMEKIVGQVHPGVKENEVYSVWSGLPSLQMADEDTRLFAFYDLLHCLRRDSHKIDSYLKLLKCRIIYNSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11008 |
Swiss-prot Accession number | P22393 (Sequence in FASTA format) |
Description | Prolactin (PRL). |
Source organism | Camelus dromedarius (Dromedary) (Arabian camel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 199 Amino acids |
Molecular weight | 22971 |
References | 1 PubMed abstract 2029533 2 PubMed abstract 2085952 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFMTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLVLRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGVKENEIYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11009 |
Swiss-prot Accession number | P33090 (Sequence in FASTA format) |
Description | Prolactin (PRL). |
Source organism | Chelonia mydas (Green sea-turtle) (Chelonia agassizi) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Chelonioidea; Cheloniidae; Chelonia. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 198 Amino acids |
Molecular weight | 22606 |
References | 1 PubMed abstract 2289679 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGSVGCQVSLENLFDRAVKLSHYIHSLSSEMFNEFDERYAQGRGFLTKAINGCHTSSLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVSEVQSIKEAPDTILKAVEIEEQDKRLLEGMEKIVGQVHPGEIENELYSPWSGLPSLQQVDEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDNDC |
Position of mature hormone in Pre-Hormone protein | 198 Residues from position (1-198) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11010 |
Swiss-prot Accession number | P34181 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Coregonus autumnalis (Baikal omul) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Coregonus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23406 |
References | 1 PubMed abstract 8364687 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALRVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDILVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11011 |
Swiss-prot Accession number | P09585 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23297 |
References | 1 PubMed abstract 3174460 2 PubMed abstract 2001405 3 PubMed abstract 3582956 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKIPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTIDSKTKELQDNINSLGAGLEHVFQKMGSSSDNLSSLPFYTSSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11012 |
Swiss-prot Accession number | P48249 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Dicentrarchus labrax (European sea bass) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Dicentrarchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 212 Amino acids |
Molecular weight | 23489 |
References | 1 PubMed abstract 7804137 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IPISDLLDRASQRSDTLHSLSTTLTQDLDSHFPPMGRVITPRPSMCHTSSLHTPIDKEQALQVSEADLLSLVRSLLQAWRDPLVILSTSANTLPHPAQNSISTKVQELLEHTKSLGDGLDILSGKFGPAAQSISSLPYRGGNDISQDRISRLTNFHFLMSCFRRDSHKIDSFLKVLRCRAAKLQPEMC |
Position of mature hormone in Pre-Hormone protein | 188 Residues from position (25-212) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11013 |
Swiss-prot Accession number | P46403 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 26282 |
References | 1 PubMed abstract 8654953 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLPTPEDKEQAQQIHHEDLLNVILRVLRSWNDPLYHLVTEVRGLHEAPDAILSRAIEIEEQNRRLLEGMEKIVHQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDSYLKLLKCRIVYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | 751517 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11014 |
Swiss-prot Accession number | P12420 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 26256 |
References | 1 PubMed abstract 12742553 2 PubMed abstract 3045032 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | 100034034 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11015 |
Swiss-prot Accession number | P35395 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL) (Fragment). |
Source organism | Hypophthalmichthys molitrix (Silver carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Hypophthalmichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 207 Amino acids |
Molecular weight | 23034 |
References | 1 PubMed abstract 1398019 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLARSLLLAWSDPLALLSSKASSLAHPERNTINSKTKELQDNINSLVPGLEHVVHKMGSSSDNLSSLPFYSNSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (21-207) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11016 |
Swiss-prot Accession number | P29235 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Hypophthalmichthys nobilis (Bighead carp) (Aristichthys nobilis) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Hypophthalmichthys. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23246 |
References | 1 PubMed abstract 1398019 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTINSKTKELQDNINSLGAGLERVVHKMGSSSDNLSSLPFYSNSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11017 |
Swiss-prot Accession number | P51904 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Ictalurus punctatus (Channel catfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 212 Amino acids |
Molecular weight | 23366 |
References | 1 Tang Y.; "A study on the channel catfish (Ictalurus punctatus) growth hormonegene family: structures of growth hormone and prolactin genes andsomatolactin cDNA, their evolutionary implications and expression inthe pituitary gland."; Thesis (1993), University of Maryland, United States.
2 PubMed abstract 1308206 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VNLNDLLDRASQLSDKMHSLSTSLTNDLDSHFSSVGGKLMRPSMCHTSSLQIPNDKDQALSVPEGELLSLVRSLLMAWSDPLALLSSEATSLPHPERNSINTKTRELQDHTNSLGAGLERLGRKMGSSPESLSSLPFNSNDLGQDNISRLVNFHFLLSCFRRDSHKIDSFLKVLRCDAAKMLPEMC |
Position of mature hormone in Pre-Hormone protein | 186 Residues from position (27-212) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11018 |
Swiss-prot Accession number | P10765 (Sequence in FASTA format) |
Description | Prolactin (PRL). |
Source organism | Loxodonta africana (African elephant) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 199 Amino acids |
Molecular weight | 22673 |
References | 1 PubMed abstract 2722400 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IPVCPRGSVRCQVSLPDLFDRAVMLSHYIHSLSSDMFHEFNKQYALGRGFIPRAINSCHTSSISTPEDKDQAQQTHHEVLMDLILGLLRSWNDPLDHLASEVHSLPKAPSALLTKATEVKEENQRLLEGIEKIVDQVHPGAKENKAYSVWSGLPSLQTTDEDARLFAFYNLFRCLRRDSHKIDSYLKLLKCRIVYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (1-199) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11019 |
Swiss-prot Accession number | P55151 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Macaca mulatta (Rhesus macaque) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 227 Amino acids |
Molecular weight | 25972 |
References | 1 PubMed abstract 8167226 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITRAINSCHTSSLPTPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMEEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWTGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (29-227) |
Receptor | N/A |
Gene ID | 707052 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11020 |
Swiss-prot Accession number | P37884 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Mesocricetus auratus (Golden hamster) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 226 Amino acids |
Molecular weight | 25582 |
References | 1 PubMed abstract 1954881 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPGGNCQMPLQELFDRVIMLSHYIYMLSADMFIELDKQYAQDHEFIAKAISDCPTSSLATPEGKEEAQQVPPEVLLNLILSLVHSWNDPLFQLVTEVDGIHEASDAIISRAKEIGEQNKRLLEGIEKILGQAYPEAKGNEIYSVWSQFPSLQGVDEESRDLAIYNKVRCLRRDSHKVDNYLKLLRCRVVHNNNC |
Position of mature hormone in Pre-Hormone protein | 197 Residues from position (30-226) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11021 |
Swiss-prot Accession number | O62819 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Monodelphis domestica (Short-tailed gray opossum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 228 Amino acids |
Molecular weight | 26071 |
References | 1 Kacsoh B., Soos G.; "Cloning and characterization of pituitary prolactin cDNA from themarsupial Monodelphis domestica."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLSDLFDRAVMLSHYIHSPSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIRHEDLLNLVLRVLRSWSEPLYHLVTEVRSMQEAPDTILLKAMEIEEQNKRLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
Receptor | N/A |
Gene ID | 100017831 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11022 |
Swiss-prot Accession number | P29234 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Mustela vison (American mink) (Neovison vison) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae;Mustelinae; Neovison. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 26194 |
References | 1 Vardy T.L., Farid A.; "Nucleotide sequence variation of the mink preprolactin gene."; Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 8307350 3 Bondar A.A., Golovin S.J., Mertvetsov N.P.; "Nucleotide sequence of mink prolactin mRNA from pituitary."; Sibirskii Biol. Zh. 2:10-15(1993). |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPTGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPDSILSRAIEIEEQNRRLLEGMEKIVGQVHPGVRENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11023 |
Swiss-prot Accession number | P21993 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23366 |
References | 1 PubMed abstract 2647439 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPEAC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | 100136792 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11024 |
Swiss-prot Accession number | P33091 (Sequence in FASTA format) |
Description | Prolactin (PRL). |
Source organism | Protopterus aethiopicus (Marbled lungfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Dipnoi; Lepidosireniformes; Protopteridae; Protopterus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 200 Amino acids |
Molecular weight | 22904 |
References | 1 PubMed abstract 8329446 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICANGSTNCHQIPLDDLFERVVKLAHRIHSLTSDMFNEFDERYAQGRGFISRAINNCHTSSLTTPEDKEQAQKFHHDDLLRLVMKVLRSWNDPLLQLVSEVPQGIGEAPGTILWKVTEVEDQTKQLIEGMEKILGRMHPNGLDNEVLSLWPMPMAMHAGDGSKLFAFYNLLHCFRRDSFKIDSYLKLLRCRLFHEGGC |
Position of mature hormone in Pre-Hormone protein | 200 Residues from position (1-200) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11025 |
Swiss-prot Accession number | P48096 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Salmo salar (Atlantic salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23396 |
References | 1 Martin S.A.M., Ferguson A., Youngson A.F.; Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2925076 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | 100136580 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11026 |
Swiss-prot Accession number | O93337 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Sparus aurata (Gilthead sea bream) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Sparus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 212 Amino acids |
Molecular weight | 23338 |
References | 1 PubMed abstract 10094859 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VPINDLLDRASQRSDMLHSLSTTLTKDLSNHVPPVGWTMMPRPPLCHTSSLQTPNDKEQALQLSESDLMSLARSLLQAWQDPLVDLSNSANSLLHPSQSSISNKIRELQEHSKSLGDGLDILSGKMGPAAQAISSLPYRGSNDIGEDNISKLTNFHFLLSCFRRDSHKIDSFLKVLRCRAAKVQPEMC |
Position of mature hormone in Pre-Hormone protein | 188 Residues from position (25-212) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11027 |
Swiss-prot Accession number | O62781 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Trichosurus vulpecula (Brush-tailed possum) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Diprotodontia; Phalangeridae; Trichosurus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation, mammogenesis, mitogenesis and osmoregulation |
Protein Length | 228 Amino acids |
Molecular weight | 26097 |
References | 1 PubMed abstract 9653022 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLSDLFDRAVMLSHYIHSPSSEMFNEFDERYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVTEVRSMQEAPDTILSKAMEIEEQNKRLLEGMEKIVGQVHPGDRENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (30-228) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11314 |
Swiss-prot Accession number | P01236 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 227 Amino acids |
Molecular weight | 25876 |
References | 1 PubMed abstract 6260780 2 PubMed abstract 6325171 3 PubMed abstract 2050267 4 PubMed abstract 15489334 5 PubMed abstract 6146607 6 PubMed abstract 9266104 7 PubMed abstract 925136 8 PubMed abstract 1126929 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (29-227) |
Receptor | P16471
Detail in HMRbase |
Gene ID | 5617 |
PDB ID | 1N9D 1RW5 2Q98 3D48 |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11315 |
Swiss-prot Accession number | P01237 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 226 Amino acids |
Molecular weight | 25753 |
References | 1 PubMed abstract 6283362 2 PubMed abstract 6251061 3 PubMed abstract 6993473 4 Shaw-Bruha C.M., Pennington K.L., Shull J.D.; Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases. 5 PubMed abstract 728396 6 PubMed abstract 925136 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC |
Position of mature hormone in Pre-Hormone protein | 197 Residues from position (30-226) |
Receptor | P05710
Detail in HMRbase |
Gene ID | 24683 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11316 |
Swiss-prot Accession number | P01238 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 26141 |
References | 1 PubMed abstract 2726463 2 PubMed abstract 2344390 3 PubMed abstract 1270193 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q6JTA8
Detail in HMRbase |
Gene ID | 396965 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11317 |
Swiss-prot Accession number | P01239 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 25793 |
References | 1 PubMed abstract 6274859 2 Cao X., Huang S.Z., Ren Z.R., Zeng Y.T.; Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 6299665 4 PubMed abstract 6897772 5 Rubtsov P.M., Oganesyan R.G., Gorbulev V.G., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones. II. Possible polymorphism ofpreprolactin in cattle. Data of molecular cloning."; Mol. Biol. (Mosk.) 22:117-127(1988). 6 PubMed abstract 4608931 7 PubMed abstract 5507606 8 PubMed abstract 8250856 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q28172
Detail in HMRbase |
Gene ID | 280901 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11318 |
Swiss-prot Accession number | P01240 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation, mammogenesis, mitogenesis and osmoregulation |
Protein Length | 229 Amino acids |
Molecular weight | 25778 |
References | 1 PubMed abstract 2911473 2 PubMed abstract 2666265 3 PubMed abstract 7969789 4 PubMed abstract 5497153 5 PubMed abstract 1270193 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | O46561
Detail in HMRbase |
Gene ID | 443317 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11378 |
Swiss-prot Accession number | P06879 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 226 Amino acids |
Molecular weight | 25496 |
References | 1 PubMed abstract 2991252 2 PubMed abstract 3756168 3 PubMed abstract 16141072 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
Position of mature hormone in Pre-Hormone protein | 197 Residues from position (30-226) |
Receptor | Q08501
Detail in HMRbase |
Gene ID | 19109 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11411 |
Swiss-prot Accession number | P14676 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 229 Amino acids |
Molecular weight | 25863 |
References | 1 PubMed abstract 2925618 2 PubMed abstract 2765112 3 Ohkubo T., Tanaka M., Nakashima K.; "Cloning and characterization of chicken prolactin gene."; Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases. 4 Au W.L., Leung F.C.; "Genomic sequence of chicken prolactin gene."; Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases. 5 Cui J.X., Liang Y., Du H.L., Zhang X.Q.; "Polymorphisms of chicken prolactin gene."; Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases. |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q04594
Detail in HMRbase |
Gene ID | 396453 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11413 |
Swiss-prot Accession number | P17572 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | Three forms are found, non-glycosylated, glycosylated and one form seems to be only O-glycosylated. |
Function | N/A |
Protein Length | 229 Amino acids |
Molecular weight | 25854 |
References | 1 PubMed abstract 8618952 2 PubMed abstract 1879669 3 PubMed abstract 2349117 4 PubMed abstract 1769204 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICSSGSVNCQVSLGELFDRAVRLSHYIHFLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQTQQIHHEELLNLILGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRIHSGDAGNEVFSQWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q91094
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |