A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10026
Swiss-prot Accession number	P11185 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera edeni (Pigmy Bryde's whale)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6071
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	RMTLSEKCCQVGCIRKDIARLC
Position of mature hormone in Pre-Hormone protein	22 Residues from position (33-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10032
Swiss-prot Accession number	P47932 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	185 Amino acids
Molecular weight	20571
References	1  PubMed abstract 8452637 2  PubMed abstract 8216305
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	RVSEEWMDGFIRMCGREYARELIKICGASVGRLAL
Position of mature hormone in Pre-Hormone protein	35 Residues from position (23-57)
Receptor	Q91ZZ5    Detail in HMRbase
Gene ID	19773
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	10034
Swiss-prot Accession number	Q9TRM8 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Placenta; syncytiotrophoblast
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	177 Amino acids
Molecular weight	20563
References	1  PubMed abstract 10026098 2  PubMed abstract 1388669
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE
Position of mature hormone in Pre-Hormone protein	35 Residues from position (26-60)
Receptor	Q5XM32    Detail in HMRbase
Gene ID	403742
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	10055
Swiss-prot Accession number	Q17192 (Sequence in FASTA format)
Description	Bombyxin A-1 precursor (BBX-A1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-1 B chain; Bombyxin A-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10271
References	1   Iwami M., Kawakami A., Ishizaki H., Takahashi S.Y., Adachi T.,Suzuki Y., Nagasawa H., Suzuki A.; "Cloning of a gene encoding bombyxin, an insulin-like brain secretorypeptide of the silkmoth Bombyx mori with prothoracicotropicactivity."; Dev. Growth Differ. 31:31-37(1989). 2  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-1 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10087
Swiss-prot Accession number	Q17192 (Sequence in FASTA format)
Description	Bombyxin A-1 precursor (BBX-A1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-1 B chain; Bombyxin A-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10271
References	1   Iwami M., Kawakami A., Ishizaki H., Takahashi S.Y., Adachi T.,Suzuki Y., Nagasawa H., Suzuki A.; "Cloning of a gene encoding bombyxin, an insulin-like brain secretorypeptide of the silkmoth Bombyx mori with prothoracicotropicactivity."; Dev. Growth Differ. 31:31-37(1989). 2  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-1 B chain
Mature Hormone Sequence	QQPQRVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10088
Swiss-prot Accession number	Q17194 (Sequence in FASTA format)
Description	Bombyxin B-10 precursor (BBX-B10) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-10 B chain; Bombyxin B-10 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	87 Amino acids
Molecular weight	9881
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-10 B chain
Mature Hormone Sequence	QEVAHTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	24 Residues from position (20-43)
Receptor	N/A
Gene ID	100169715
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10089
Swiss-prot Accession number	Q17194 (Sequence in FASTA format)
Description	Bombyxin B-10 precursor (BBX-B10) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-10 B chain; Bombyxin B-10 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	87 Amino acids
Molecular weight	9881
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-10 A chain
Mature Hormone Sequence	SVVDECCFRPCTLDVLLSYCD
Position of mature hormone in Pre-Hormone protein	21 Residues from position (67-87)
Receptor	N/A
Gene ID	100169715
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10090
Swiss-prot Accession number	Q17196 (Sequence in FASTA format)
Description	Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	93 Amino acids
Molecular weight	10744
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-11 B chain
Mature Hormone Sequence	QEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	24 Residues from position (23-46)
Receptor	N/A
Gene ID	100169656
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10093
Swiss-prot Accession number	P26736 (Sequence in FASTA format)
Description	Bombyxin D-1 precursor (BBX-D1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin D-1 B chain; Bombyxin D-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10106
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin D-1 A chain
Mature Hormone Sequence	GIADECCLQPCTNDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (71-90)
Receptor	N/A
Gene ID	100169725
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10168
Swiss-prot Accession number	P81423 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Acipenser guldenstadti (Caspian sturgeon) (Russian sturgeon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5811
References	1  PubMed abstract 9650713
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYTPNKV
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10169
Swiss-prot Accession number	P81423 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Acipenser guldenstadti (Caspian sturgeon) (Russian sturgeon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5811
References	1  PubMed abstract 9650713
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHSPCSLYDLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (32-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10170
Swiss-prot Accession number	Q6YK33 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10171
Swiss-prot Accession number	Q6YK33 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gorilla gorilla gorilla (Lowland gorilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Gorilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10172
Swiss-prot Accession number	P68988 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lampetra fluviatilis (River lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 8575665
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	SALTGAGGTHLCGSHLVEALYVVCGDRGFFYTPSKT
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10173
Swiss-prot Accession number	P81025 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	113 Amino acids
Molecular weight	12480
References	1  PubMed abstract 9972302 2  PubMed abstract 7656183
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VGGPQHLCGSHLVDALYLVCGDRGFFYNPR
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10174
Swiss-prot Accession number	P81025 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	113 Amino acids
Molecular weight	12480
References	1  PubMed abstract 9972302 2  PubMed abstract 7656183
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEECCHKPCTIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (93-113)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10175
Swiss-prot Accession number	Q9TQY7 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Ornithorhynchus anatinus (Duckbill platypus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5854
References	1  PubMed abstract 8868070
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FPNQHLCGSHLVEALYLVCGEKGFYYIPRM
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	10176
Swiss-prot Accession number	Q9TQY7 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Ornithorhynchus anatinus (Duckbill platypus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5854
References	1  PubMed abstract 8868070
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEECCKGVCSMYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	10177
Swiss-prot Accession number	Q98TA8 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pantodon buchholtzi (Butterflyfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Osteoglossomorpha;Osteoglossiformes; Pantodontidae; Pantodon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12324
References	1  PubMed abstract 11306171
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	ASSQHLCGSHLVDALYMVCGEKGFFYQPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (24-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	10178
Swiss-prot Accession number	Q98TA8 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pantodon buchholtzi (Butterflyfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Osteoglossomorpha;Osteoglossiformes; Pantodontidae; Pantodon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12324
References	1  PubMed abstract 11306171
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHHPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	10179
Swiss-prot Accession number	P81881 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Piaractus mesopotamicus (Pacu)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes;Characidae; Piaractus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5673
References	1  PubMed abstract 10327603
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	NAGAPQHLCGSHLVDALYLVCGPSGFFYNPK
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	10180
Swiss-prot Accession number	P81881 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Piaractus mesopotamicus (Pacu)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes;Characidae; Piaractus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5673
References	1  PubMed abstract 10327603
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCSIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (32-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	10181
Swiss-prot Accession number	Q8HXV2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12038
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	10182
Swiss-prot Accession number	Q8HXV2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pongo pygmaeus (Orangutan)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pongo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12038
References	1  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	10183
Swiss-prot Accession number	Q62587 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Psammomys obesus (Fat sand rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Gerbillinae; Psammomys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12324
References	1  PubMed abstract 9166665
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKF
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	10184
Swiss-prot Accession number	Q62587 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Psammomys obesus (Fat sand rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Gerbillinae; Psammomys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12324
References	1  PubMed abstract 9166665
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTGICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 27

HMRbase accession number	10185
Swiss-prot Accession number	Q91XI3 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Spermophilus tridecemlineatus (Thirteen-lined ground squirrel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Sciuridae; Xerinae; Marmotini; Spermophilus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12004
References	1   Tredrea M.M., Buck M.J., Guhaniyogi J., Squire T.L., Andrews M.T.; "Regulation of PDK4 expression in a hibernating mammal."; Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 28

HMRbase accession number	10186
Swiss-prot Accession number	Q91XI3 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Spermophilus tridecemlineatus (Thirteen-lined ground squirrel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Sciuridae; Xerinae; Marmotini; Spermophilus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12004
References	1   Tredrea M.M., Buck M.J., Guhaniyogi J., Squire T.L., Andrews M.T.; "Regulation of PDK4 expression in a hibernating mammal."; Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 29

HMRbase accession number	10187
Swiss-prot Accession number	Q9W7R2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12608
References	1   Andoh T., Nagasawa H.; "Two molecular forms of insulin from barfin flounder, Verasper moseri,are derived from a single gene."; Zool. Sci. 15:931-937(1998).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	QAVLPPQHLCGAHLVDALYLVCGERGFFYTP
Position of mature hormone in Pre-Hormone protein	31 Residues from position (23-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 30

HMRbase accession number	10288
Swiss-prot Accession number	Q5CZK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin H3) [Contains: Relaxin-3 B chain;Relaxin-3 A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 (GPCR135) and relaxin-3 receptor-2 (GPCR142)
Protein Length	142 Amino acids
Molecular weight	15348
References	1  PubMed abstract 16136131 2  PubMed abstract 15707501
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RAAPYGVRLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (26-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 31

HMRbase accession number	10289
Swiss-prot Accession number	Q5CZK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin H3) [Contains: Relaxin-3 B chain;Relaxin-3 A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 (GPCR135) and relaxin-3 receptor-2 (GPCR142)
Protein Length	142 Amino acids
Molecular weight	15348
References	1  PubMed abstract 16136131 2  PubMed abstract 15707501
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSSCCKWGCSKSEISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (119-142)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 32

HMRbase accession number	10290
Swiss-prot Accession number	Q8HY17 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Insulin-like peptide INSL7) (Insulin-like peptide7) [Contains: Relaxin-3 B chain; Relaxin-3 A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	140 Amino acids
Molecular weight	15360
References	1  PubMed abstract 12686464 2  PubMed abstract 12506116 3  PubMed abstract 14522968
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RASPYGVKLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (27-53)
Receptor	N/A
Gene ID	503836
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 33

HMRbase accession number	10291
Swiss-prot Accession number	Q8HY17 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Insulin-like peptide INSL7) (Insulin-like peptide7) [Contains: Relaxin-3 B chain; Relaxin-3 A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-3
Protein Length	140 Amino acids
Molecular weight	15360
References	1  PubMed abstract 12686464 2  PubMed abstract 12506116 3  PubMed abstract 14522968
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSNCCKWGCSKSEISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (117-140)
Receptor	N/A
Gene ID	503836
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 34

HMRbase accession number	10292
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QEEVLKACGREFVRLQIRICGSLSWG
Position of mature hormone in Pre-Hormone protein	26 Residues from position (26-51)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 35

HMRbase accession number	10293
Swiss-prot Accession number	Q9MYK8 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed by the placenta. Exclusively detected in cells located in the lamellar placental labyrinth and absent from other placental and nonplacental uterine parts
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	180 Amino acids
Molecular weight	20360
References	1  PubMed abstract 9915995
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	SDYIRYSDRCCNVGCTRKELADLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (157-180)
Receptor	N/A
Gene ID	493883
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 36

HMRbase accession number	10294
Swiss-prot Accession number	Q64171 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mesocricetus auratus (Golden hamster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones
Protein Length	177 Amino acids
Molecular weight	20007
References	1  PubMed abstract 7492700
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	RVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPL
Position of mature hormone in Pre-Hormone protein	37 Residues from position (23-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 37

HMRbase accession number	10295
Swiss-prot Accession number	Q64171 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mesocricetus auratus (Golden hamster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young, and allows separation of the pelvic bones
Protein Length	177 Amino acids
Molecular weight	20007
References	1  PubMed abstract 7492700
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	YTSIYMSHQCCFRGCSRRSLTAAC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (154-177)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 38

HMRbase accession number	10332
Swiss-prot Accession number	Q8CHK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin M3) (Insulin-like peptide INSL7)(Insulin-like peptide 7) [Contains: Relaxin-3 B chain; Relaxin-3 Achain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	High expression in the brain localized to the pons/medulla with highest levels in pars ventromedialis of the dorsal tegmental nucleus. Significant expression is also detected in the spleen, thymus, lung, testis and ovary
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	141 Amino acids
Molecular weight	14926
References	1  PubMed abstract 12686464 2  PubMed abstract 11689565
Domain Name	Insulin
Hormone Name	Relaxin-3 B chain
Mature Hormone Sequence	RPAPYGVKLCGREFIRAVIFTCGGSRW
Position of mature hormone in Pre-Hormone protein	27 Residues from position (25-51)
Receptor	Q8BGE9   Detail in HMRbase    Q7TQP4   Detail in HMRbase    Q91ZZ5    Detail in HMRbase
Gene ID	212108
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	10333
Swiss-prot Accession number	Q8CHK2 (Sequence in FASTA format)
Description	Relaxin-3 precursor (Prorelaxin M3) (Insulin-like peptide INSL7)(Insulin-like peptide 7) [Contains: Relaxin-3 B chain; Relaxin-3 Achain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	High expression in the brain localized to the pons/medulla with highest levels in pars ventromedialis of the dorsal tegmental nucleus. Significant expression is also detected in the spleen, thymus, lung, testis and ovary
Post translational modification	N/A
Function	May play a role in neuropeptide signaling processes. Ligand for LGR7, relaxin-3 receptor-1 and relaxin-3 receptor-2
Protein Length	141 Amino acids
Molecular weight	14926
References	1  PubMed abstract 12686464 2  PubMed abstract 11689565
Domain Name	Insulin
Hormone Name	Relaxin-3 A chain
Mature Hormone Sequence	DVLAGLSSSCCEWGCSKSQISSLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (118-141)
Receptor	Q8BGE9   Detail in HMRbase    Q7TQP4   Detail in HMRbase    Q91ZZ5    Detail in HMRbase
Gene ID	212108
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 40

HMRbase accession number	10366
Swiss-prot Accession number	Q9TRM8 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Placenta; syncytiotrophoblast
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	177 Amino acids
Molecular weight	20563
References	1  PubMed abstract 10026098 2  PubMed abstract 1388669
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	DNYIKMSDKCCNVGCTRRELASRC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (154-177)
Receptor	Q5XM32    Detail in HMRbase
Gene ID	403742
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 41

HMRbase accession number	10451
Swiss-prot Accession number	P29519 (Sequence in FASTA format)
Description	Bombyxin B-12 precursor (BBX-B12) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-12 B chain; Bombyxin B-12 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10124
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-12 B chain
Mature Hormone Sequence	EEQEVARTYCGAHLANTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169722
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 42

HMRbase accession number	10527
Swiss-prot Accession number	P15411 (Sequence in FASTA format)
Description	Bombyxin A-2 precursor (BBX-A2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-2 B chain; Bombyxin A-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9979
References	1  PubMed abstract 2708384 2  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-2 B chain
Mature Hormone Sequence	QQPQEVHTYCGRHLARTMADLCWEEGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	693012
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 43

HMRbase accession number	10528
Swiss-prot Accession number	P15411 (Sequence in FASTA format)
Description	Bombyxin A-2 precursor (BBX-A2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-2 B chain; Bombyxin A-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9979
References	1  PubMed abstract 2708384 2  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-2 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (70-89)
Receptor	N/A
Gene ID	693012
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 44

HMRbase accession number	10529
Swiss-prot Accession number	P26726 (Sequence in FASTA format)
Description	Bombyxin A-3 precursor (BBX-A3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-3 B chain; Bombyxin A-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10273
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-3 B chain
Mature Hormone Sequence	QQPQGVHTYCGRHLARTLANLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 45

HMRbase accession number	10530
Swiss-prot Accession number	P26726 (Sequence in FASTA format)
Description	Bombyxin A-3 precursor (BBX-A3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-3 B chain; Bombyxin A-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10273
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-3 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 46

HMRbase accession number	10531
Swiss-prot Accession number	P26727 (Sequence in FASTA format)
Description	Bombyxin A-4 precursor (BBX-A4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-4 B chain; Bombyxin A-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10172
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-4 B chain
Mature Hormone Sequence	QQPQGVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169657
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 47

HMRbase accession number	10532
Swiss-prot Accession number	P26727 (Sequence in FASTA format)
Description	Bombyxin A-4 precursor (BBX-A4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-4 B chain; Bombyxin A-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10172
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-4 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169657
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 48

HMRbase accession number	10533
Swiss-prot Accession number	P26728 (Sequence in FASTA format)
Description	Bombyxin A-5 precursor (BBX-A5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-5 B chain; Bombyxin A-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10299
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-5 B chain
Mature Hormone Sequence	QQPQTVHTYCGHHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169658
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 49

HMRbase accession number	10534
Swiss-prot Accession number	P26728 (Sequence in FASTA format)
Description	Bombyxin A-5 precursor (BBX-A5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-5 B chain; Bombyxin A-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10299
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-5 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169658
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 50

HMRbase accession number	10535
Swiss-prot Accession number	P26729 (Sequence in FASTA format)
Description	Bombyxin A-6 precursor (BBX-A6) (Bombyxin-II) (4K-prothoracicotropichormone) (4K-PTTH) [Contains: Bombyxin A-6 B chain; Bombyxin A-6 Achain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10186
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744 3  PubMed abstract 7473749
Domain Name	Insulin
Hormone Name	Bombyxin A-6 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 51

HMRbase accession number	10536
Swiss-prot Accession number	P26729 (Sequence in FASTA format)
Description	Bombyxin A-6 precursor (BBX-A6) (Bombyxin-II) (4K-prothoracicotropichormone) (4K-PTTH) [Contains: Bombyxin A-6 B chain; Bombyxin A-6 Achain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10186
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744 3  PubMed abstract 7473749
Domain Name	Insulin
Hormone Name	Bombyxin A-6 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 52

HMRbase accession number	10537
Swiss-prot Accession number	P26730 (Sequence in FASTA format)
Description	Bombyxin A-7 precursor (BBX-A7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-7 B chain; Bombyxin A-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10286
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-7 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 53

HMRbase accession number	10538
Swiss-prot Accession number	P26730 (Sequence in FASTA format)
Description	Bombyxin A-7 precursor (BBX-A7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-7 B chain; Bombyxin A-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10286
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-7 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 54

HMRbase accession number	10539
Swiss-prot Accession number	P26731 (Sequence in FASTA format)
Description	Bombyxin A-8 precursor (BBX-A8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-8 B chain; Bombyxin A-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9951
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-8 B chain
Mature Hormone Sequence	QQPQEVHTYCGRHLARTMADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169709
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 55

HMRbase accession number	10540
Swiss-prot Accession number	P26731 (Sequence in FASTA format)
Description	Bombyxin A-8 precursor (BBX-A8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-8 B chain; Bombyxin A-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9951
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-8 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169709
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 56

HMRbase accession number	10541
Swiss-prot Accession number	P26732 (Sequence in FASTA format)
Description	Bombyxin A-9 precursor (BBX-A9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-9 B chain; Bombyxin A-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10288
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-9 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 57

HMRbase accession number	10542
Swiss-prot Accession number	P26732 (Sequence in FASTA format)
Description	Bombyxin A-9 precursor (BBX-A9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-9 B chain; Bombyxin A-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10288
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-9 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 58

HMRbase accession number	10543
Swiss-prot Accession number	Q17196 (Sequence in FASTA format)
Description	Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	93 Amino acids
Molecular weight	10744
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-11 A chain
Mature Hormone Sequence	GPGVVDECCFRPCKLEVLKSFFFFFCD
Position of mature hormone in Pre-Hormone protein	27 Residues from position (67-93)
Receptor	N/A
Gene ID	100169656
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 59

HMRbase accession number	10544
Swiss-prot Accession number	P29519 (Sequence in FASTA format)
Description	Bombyxin B-12 precursor (BBX-B12) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-12 B chain; Bombyxin B-12 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10124
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-12 A chain
Mature Hormone Sequence	GVVDECCFQPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169722
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 60

HMRbase accession number	10545
Swiss-prot Accession number	P26733 (Sequence in FASTA format)
Description	Bombyxin B-1 precursor (BBX-B1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-1 B chain; Bombyxin B-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9945
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-1 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (20-45)
Receptor	N/A
Gene ID	100169719
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 61

HMRbase accession number	10546
Swiss-prot Accession number	P26733 (Sequence in FASTA format)
Description	Bombyxin B-1 precursor (BBX-B1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-1 B chain; Bombyxin B-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9945
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-1 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	100169719
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 62

HMRbase accession number	10547
Swiss-prot Accession number	P26734 (Sequence in FASTA format)
Description	Bombyxin B-2 precursor (BBX-B2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-2 B chain; Bombyxin B-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	10039
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-2 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (20-45)
Receptor	N/A
Gene ID	100169721
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 63

HMRbase accession number	10548
Swiss-prot Accession number	P26734 (Sequence in FASTA format)
Description	Bombyxin B-2 precursor (BBX-B2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-2 B chain; Bombyxin B-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	10039
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-2 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	100169721
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 64

HMRbase accession number	10549
Swiss-prot Accession number	P26737 (Sequence in FASTA format)
Description	Bombyxin B-3 precursor (BBX-B3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-3 B chain; Bombyxin B-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10152
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-3 B chain
Mature Hormone Sequence	EEQEVARTYCGAHLANTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 65

HMRbase accession number	10550
Swiss-prot Accession number	P26737 (Sequence in FASTA format)
Description	Bombyxin B-3 precursor (BBX-B3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-3 B chain; Bombyxin B-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10152
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-3 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 66

HMRbase accession number	10551
Swiss-prot Accession number	P26738 (Sequence in FASTA format)
Description	Bombyxin B-4 precursor (BBX-B4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-4 B chain; Bombyxin B-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10103
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-4 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169720
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 67

HMRbase accession number	10552
Swiss-prot Accession number	P26738 (Sequence in FASTA format)
Description	Bombyxin B-4 precursor (BBX-B4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-4 B chain; Bombyxin B-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10103
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-4 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169720
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 68

HMRbase accession number	10553
Swiss-prot Accession number	P26739 (Sequence in FASTA format)
Description	Bombyxin B-5 precursor (BBX-B5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-5 B chain; Bombyxin B-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10212
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-5 B chain
Mature Hormone Sequence	EEQEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 69

HMRbase accession number	10554
Swiss-prot Accession number	P26739 (Sequence in FASTA format)
Description	Bombyxin B-5 precursor (BBX-B5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-5 B chain; Bombyxin B-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10212
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-5 A chain
Mature Hormone Sequence	GPGVVDECCFRPCKLEVLKSYCGV
Position of mature hormone in Pre-Hormone protein	24 Residues from position (67-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 70

HMRbase accession number	10555
Swiss-prot Accession number	P26740 (Sequence in FASTA format)
Description	Bombyxin B-6 precursor (BBX-B6) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-6 B chain; Bombyxin B-6 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10112
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-6 B chain
Mature Hormone Sequence	EAQEVARTYCGRDLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169723
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 71

HMRbase accession number	10556
Swiss-prot Accession number	P26740 (Sequence in FASTA format)
Description	Bombyxin B-6 precursor (BBX-B6) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-6 B chain; Bombyxin B-6 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10112
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-6 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169723
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 72

HMRbase accession number	10557
Swiss-prot Accession number	P26741 (Sequence in FASTA format)
Description	Bombyxin B-7 precursor (BBX-B7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-7 B chain; Bombyxin B-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10028
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-7 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 73

HMRbase accession number	10558
Swiss-prot Accession number	P26741 (Sequence in FASTA format)
Description	Bombyxin B-7 precursor (BBX-B7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-7 B chain; Bombyxin B-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10028
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-7 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 74

HMRbase accession number	10559
Swiss-prot Accession number	P26742 (Sequence in FASTA format)
Description	Bombyxin B-8 precursor (BBX-B8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-8 B chain; Bombyxin B-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	88 Amino acids
Molecular weight	9706
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-8 B chain
Mature Hormone Sequence	EAQEVARTYCGSHLADTLADLCFGVV
Position of mature hormone in Pre-Hormone protein	26 Residues from position (19-44)
Receptor	N/A
Gene ID	100169718
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 75

HMRbase accession number	10560
Swiss-prot Accession number	P26742 (Sequence in FASTA format)
Description	Bombyxin B-8 precursor (BBX-B8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-8 B chain; Bombyxin B-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	88 Amino acids
Molecular weight	9706
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-8 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLASYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (68-88)
Receptor	N/A
Gene ID	100169718
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 76

HMRbase accession number	10561
Swiss-prot Accession number	P26743 (Sequence in FASTA format)
Description	Bombyxin B-9 precursor (BBX-B9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-9 B chain; Bombyxin B-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10284
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-9 B chain
Mature Hormone Sequence	EEQEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 77

HMRbase accession number	10562
Swiss-prot Accession number	P26743 (Sequence in FASTA format)
Description	Bombyxin B-9 precursor (BBX-B9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-9 B chain; Bombyxin B-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10284
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-9 A chain
Mature Hormone Sequence	EPGVVDECCFRPCKLEVLKSYCGV
Position of mature hormone in Pre-Hormone protein	24 Residues from position (67-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 78

HMRbase accession number	10563
Swiss-prot Accession number	P15410 (Sequence in FASTA format)
Description	Bombyxin C-1 precursor (BBX-C1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-1 B chain; Bombyxin C-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	91 Amino acids
Molecular weight	10137
References	1   Iwami M., Adachi T., Kondo H., Kawakami A., Suzuki Y., Nagasawa H.,Suzuki A., Ishizaki H.; "A novel family C of the genes that encode bombyxin, an insulin-related brain secretory peptide of the silkmoth Bombyx mori: isolationand characterization of gene C-1."; Insect Biochem. 20:295-303(1990). 2  PubMed abstract 8683595 3  PubMed abstract 2708384
Domain Name	Insulin
Hormone Name	Bombyxin C-1 B chain
Mature Hormone Sequence	QTASQFYCGDFLARTMSSLCWSDMQ
Position of mature hormone in Pre-Hormone protein	25 Residues from position (20-44)
Receptor	N/A
Gene ID	100147698
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 79

HMRbase accession number	10564
Swiss-prot Accession number	P15410 (Sequence in FASTA format)
Description	Bombyxin C-1 precursor (BBX-C1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-1 B chain; Bombyxin C-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	91 Amino acids
Molecular weight	10137
References	1   Iwami M., Adachi T., Kondo H., Kawakami A., Suzuki Y., Nagasawa H.,Suzuki A., Ishizaki H.; "A novel family C of the genes that encode bombyxin, an insulin-related brain secretory peptide of the silkmoth Bombyx mori: isolationand characterization of gene C-1."; Insect Biochem. 20:295-303(1990). 2  PubMed abstract 8683595 3  PubMed abstract 2708384
Domain Name	Insulin
Hormone Name	Bombyxin C-1 A chain
Mature Hormone Sequence	GIVDECCYRPCTIDVLMSYCDN
Position of mature hormone in Pre-Hormone protein	22 Residues from position (70-91)
Receptor	N/A
Gene ID	100147698
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 80

HMRbase accession number	10565
Swiss-prot Accession number	P26735 (Sequence in FASTA format)
Description	Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	95 Amino acids
Molecular weight	10605
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin C-2 B chain
Mature Hormone Sequence	QTASQFYCGDFLARTMSILCWPDMP
Position of mature hormone in Pre-Hormone protein	25 Residues from position (20-44)
Receptor	N/A
Gene ID	100147697
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 81

HMRbase accession number	10566
Swiss-prot Accession number	P26735 (Sequence in FASTA format)
Description	Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	95 Amino acids
Molecular weight	10605
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin C-2 A chain
Mature Hormone Sequence	GIVDECCYRPCTTDVLKLYCDKQITI
Position of mature hormone in Pre-Hormone protein	26 Residues from position (70-95)
Receptor	N/A
Gene ID	100147697
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 82

HMRbase accession number	10567
Swiss-prot Accession number	P26736 (Sequence in FASTA format)
Description	Bombyxin D-1 precursor (BBX-D1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin D-1 B chain; Bombyxin D-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10106
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin D-1 B chain
Mature Hormone Sequence	ASEEGHIYCGRYLAYKMADLCWRAGFE
Position of mature hormone in Pre-Hormone protein	27 Residues from position (19-45)
Receptor	N/A
Gene ID	100169725
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 83

HMRbase accession number	10568
Swiss-prot Accession number	P21808 (Sequence in FASTA format)
Description	Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropichormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTTH is a brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	98 Amino acids
Molecular weight	10987
References	1  PubMed abstract 9253178 2   Maruyama K., Hietter H., Nagasawa H., Isogai A., Tamura S., Suzuki A.,Ishizaki H.; "Isolation and primary structure of bombyxin-IV, a novel molecularspecies of bombyxin from the silkworm, Bombyx mori."; Agric. Biol. Chem. 52:3035-3041(1988). 3  PubMed abstract 1515030
Domain Name	Insulin
Hormone Name	Bombyxin E-1 B chain
Mature Hormone Sequence	QEANVAHHYCGRHLANTLADLCWDTSVE
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100146109
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 84

HMRbase accession number	10569
Swiss-prot Accession number	P21808 (Sequence in FASTA format)
Description	Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropichormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTTH is a brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	98 Amino acids
Molecular weight	10987
References	1  PubMed abstract 9253178 2   Maruyama K., Hietter H., Nagasawa H., Isogai A., Tamura S., Suzuki A.,Ishizaki H.; "Isolation and primary structure of bombyxin-IV, a novel molecularspecies of bombyxin from the silkworm, Bombyx mori."; Agric. Biol. Chem. 52:3035-3041(1988). 3  PubMed abstract 1515030
Domain Name	Insulin
Hormone Name	Bombyxin E-1 A chain
Mature Hormone Sequence	GVVDECCIQPCTLDVLATYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (79-98)
Receptor	N/A
Gene ID	100146109
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 85

HMRbase accession number	10782
Swiss-prot Accession number	P29335 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Amia calva (Bowfin)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Amiiformes; Amiidae; Amia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5777
References	1  PubMed abstract 2039477
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AASQHLCGSHLVEALFLVCGESGFFYNPNKS
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 86

HMRbase accession number	10783
Swiss-prot Accession number	P29335 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Amia calva (Bowfin)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Amiiformes; Amiidae; Amia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5777
References	1  PubMed abstract 2039477
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCLKPCTIYEMEKYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (32-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 87

HMRbase accession number	10784
Swiss-prot Accession number	P01324 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Acomys cahirinus (Egyptian spiny mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Deomyinae; Acomys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5768
References	1  PubMed abstract 5028210
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVBQHLCGSHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 88

HMRbase accession number	10785
Swiss-prot Accession number	P01324 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Acomys cahirinus (Egyptian spiny mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Deomyinae; Acomys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5768
References	1  PubMed abstract 5028210
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 89

HMRbase accession number	10786
Swiss-prot Accession number	P12703 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Alligator mississippiensis (American alligator)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5689
References	1  PubMed abstract 6146554
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQRLCGSHLVDALYLVCGERGFFYSPKG
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 90

HMRbase accession number	10787
Swiss-prot Accession number	P12703 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Alligator mississippiensis (American alligator)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5689
References	1  PubMed abstract 6146554
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 91

HMRbase accession number	10788
Swiss-prot Accession number	P01333 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Anas platyrhynchos (Domestic duck)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anas.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	81 Amino acids
Molecular weight	9105
References	1  PubMed abstract 4763354 2  PubMed abstract 4715652
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 92

HMRbase accession number	10789
Swiss-prot Accession number	P01333 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Anas platyrhynchos (Domestic duck)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anas.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	81 Amino acids
Molecular weight	9105
References	1  PubMed abstract 4763354 2  PubMed abstract 4715652
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCENPCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (61-81)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 93

HMRbase accession number	10790
Swiss-prot Accession number	P42633 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Anguilla rostrata (American eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5652
References	1  PubMed abstract 1874385
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	ASTQHLCGSHLVEALYLVCGSNGFFFNPKD
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 94

HMRbase accession number	10791
Swiss-prot Accession number	P42633 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Anguilla rostrata (American eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5652
References	1  PubMed abstract 1874385
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCSIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 95

HMRbase accession number	10792
Swiss-prot Accession number	P68245 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Anser anser anser (Western graylag goose)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anser.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5716
References	1   Xu Y., Lin N., Zhang Y., Zhang Y.; "Isolation and sequence determination of goose insulin."; Kexue Tongbao 28:966-968(1983).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 96

HMRbase accession number	10793
Swiss-prot Accession number	P68245 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Anser anser anser (Western graylag goose)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anser.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5716
References	1   Xu Y., Lin N., Zhang Y., Zhang Y.; "Isolation and sequence determination of goose insulin."; Kexue Tongbao 28:966-968(1983).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCENPCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 97

HMRbase accession number	10794
Swiss-prot Accession number	P67972 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Aotus trivirgatus (Night monkey) (Douroucouli)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Aotidae; Aotus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11842
References	1  PubMed abstract 3118367
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGPHLVEALYLVCGERGFFYAPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 98

HMRbase accession number	10795
Swiss-prot Accession number	P67972 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Aotus trivirgatus (Night monkey) (Douroucouli)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Aotidae; Aotus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11842
References	1  PubMed abstract 3118367
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GVVDQCCTSICSLYQLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 99

HMRbase accession number	10796
Swiss-prot Accession number	P01314 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Balaenoptera borealis (Sei whale) (Pollack whale)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5724
References	1  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 100

HMRbase accession number	10797
Swiss-prot Accession number	P01314 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Balaenoptera borealis (Sei whale) (Pollack whale)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5724
References	1  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 101

HMRbase accession number	10798
Swiss-prot Accession number	P67973 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Balaenoptera physalus (Finback whale) (Common rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 14228503
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 102

HMRbase accession number	10799
Swiss-prot Accession number	P67973 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Balaenoptera physalus (Finback whale) (Common rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 14228503
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 103

HMRbase accession number	10800
Swiss-prot Accession number	P01317 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11393
References	1  PubMed abstract 2456452 2  PubMed abstract 4928892 3  PubMed abstract 14886311 4  PubMed abstract 5545080 5  PubMed abstract 5105368 6  PubMed abstract 13032079 7  PubMed abstract 13249947 8   Smith G.D., Duax W.L., Dodson E.J., Dodson G.G., de Graaf R.A.G.,Reynolds C.D.; "The structure of des-Phe b1 bovine insulin."; Acta Crystallogr. B 38:3028-3032(1982). 9  PubMed abstract 9141131
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	280829
PDB ID	1APH   1BPH   1CPH   1DPH   1HO0   1PID   2A3G   2BN1   2BN3   2INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 104

HMRbase accession number	10801
Swiss-prot Accession number	P01317 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Mevtazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11393
References	1  PubMed abstract 2456452 2  PubMed abstract 4928892 3  PubMed abstract 14886311 4  PubMed abstract 5545080 5  PubMed abstract 5105368 6  PubMed abstract 13032079 7  PubMed abstract 13249947 8   Smith G.D., Duax W.L., Dodson E.J., Dodson G.G., de Graaf R.A.G.,Reynolds C.D.; "The structure of des-Phe b1 bovine insulin."; Acta Crystallogr. B 38:3028-3032(1982). 9  PubMed abstract 9141131
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (85-105)
Receptor	N/A
Gene ID	280829
PDB ID	1APH   1BPH   1CPH   1DPH   1HO0   1PID   2A3G   2BN1   2BN3   2INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 105

HMRbase accession number	10802
Swiss-prot Accession number	P68243 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Cairina moschata (Muscovy duck)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Cairina.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5716
References	1  PubMed abstract 8759296
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 106

HMRbase accession number	10803
Swiss-prot Accession number	P68243 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Cairina moschata (Muscovy duck)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Cairina.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5716
References	1  PubMed abstract 8759296
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCENPCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 107

HMRbase accession number	10804
Swiss-prot Accession number	P13190 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Callorhynchus milii (Elephant shark) (Elephantfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	89 Amino acids
Molecular weight	10147
References	1   Gieseg M.A., Swarbrick P.A., Perko L., Powell R.J., Cutfield J.F.; "A monobasic proinsulin processing site."; Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2690815
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VPTQRLCGSHLVDALYFVCGERGFFYSPKQI
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 108

HMRbase accession number	10805
Swiss-prot Accession number	P13190 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Callorhynchus milii (Elephant shark) (Elephantfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	89 Amino acids
Molecular weight	10147
References	1   Gieseg M.A., Swarbrick P.A., Perko L., Powell R.J., Cutfield J.F.; "A monobasic proinsulin processing site."; Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2690815
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLVNLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 109

HMRbase accession number	10806
Swiss-prot Accession number	P01320 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5694
References	1   Danho W.O.; "The isolation and characterization of insulin of camel (Camelusdromedarius)."; J. Fac. Med. Baghdad 14:16-28(1972).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FANQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 110

HMRbase accession number	10807
Swiss-prot Accession number	P01320 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Camelus dromedarius (Dromedary) (Arabian camel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;Camelidae; Camelus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5694
References	1   Danho W.O.; "The isolation and characterization of insulin of camel (Camelusdromedarius)."; J. Fac. Med. Baghdad 14:16-28(1972).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 111

HMRbase accession number	10808
Swiss-prot Accession number	P01321 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12190
References	1  PubMed abstract 6296142 2  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	483665
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 112

HMRbase accession number	10809
Swiss-prot Accession number	P01321 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12190
References	1  PubMed abstract 6296142 2  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	483665
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 113

HMRbase accession number	10810
Swiss-prot Accession number	P01319 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Capra hircus (Goat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5692
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 114

HMRbase accession number	10811
Swiss-prot Accession number	P01319 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Capra hircus (Goat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5692
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCAGVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 115

HMRbase accession number	10812
Swiss-prot Accession number	P01329 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12187
References	1  PubMed abstract 3839794 2  PubMed abstract 6591179 3  PubMed abstract 5949593 4   Smith L.F.; "Amino acid sequences of insulins."; Diabetes 21 Suppl. 2:457-460(1972). 5  PubMed abstract 1158864
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVSRHLCGSNLVETLYSVCQDDGFFYIPKD
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 116

HMRbase accession number	10813
Swiss-prot Accession number	P01329 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cavia porcellus (Guinea pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12187
References	1  PubMed abstract 3839794 2  PubMed abstract 6591179 3  PubMed abstract 5949593 4   Smith L.F.; "Amino acid sequences of insulins."; Diabetes 21 Suppl. 2:457-460(1972). 5  PubMed abstract 1158864
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTGTCTRHQLQSYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 117

HMRbase accession number	10814
Swiss-prot Accession number	P30407 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cercopithecus aethiops (Green monkey) (Grivet)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12019
References	1  PubMed abstract 1560757 2  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 118

HMRbase accession number	10815
Swiss-prot Accession number	P30407 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cercopithecus aethiops (Green monkey) (Grivet)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12019
References	1  PubMed abstract 1560757 2  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 119

HMRbase accession number	10816
Swiss-prot Accession number	P01327 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9470
References	1  PubMed abstract 1175610 2  PubMed abstract 808541
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNKHLCGSHLVDALYLVCGDRGFFYTPMA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 120

HMRbase accession number	10817
Swiss-prot Accession number	P01327 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Chinchilla brevicaudata (Chinchilla)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9470
References	1  PubMed abstract 1175610 2  PubMed abstract 808541
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTSICTLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (66-86)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 121

HMRbase accession number	10818
Swiss-prot Accession number	P67970 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	107 Amino acids
Molecular weight	11981
References	1  PubMed abstract 7388949 2   Hasegawa S., Honda K., Nata K., Yonekura H., Okamoto H., Hikami Y.; "Isolation of a cDNA encoding chicken insulin precursor."; Anim. Sci. Technol. 62:867-869(1991). 3   Nie Q., Fang M., Sun B., Lei M., Zhang X.; "Complete coding region of chicken preproinsulin gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	396145
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 122

HMRbase accession number	10819
Swiss-prot Accession number	P67970 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	107 Amino acids
Molecular weight	11981
References	1  PubMed abstract 7388949 2   Hasegawa S., Honda K., Nata K., Yonekura H., Okamoto H., Hikami Y.; "Isolation of a cDNA encoding chicken insulin precursor."; Anim. Sci. Technol. 62:867-869(1991). 3   Nie Q., Fang M., Sun B., Lei M., Zhang X.; "Complete coding region of chicken preproinsulin gene."; Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases. 4  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (87-107)
Receptor	N/A
Gene ID	396145
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 123

HMRbase accession number	10820
Swiss-prot Accession number	P68991 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Chimaera monstrosa (Rabbit fish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Chimaera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3053327
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VPTQRLCGSHLVDALYFVCGERGFFYSPKPIRELEPLL
Position of mature hormone in Pre-Hormone protein	38 Residues from position (1-38)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 124

HMRbase accession number	10821
Swiss-prot Accession number	P68991 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Chimaera monstrosa (Rabbit fish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Chimaera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3053327
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLANLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (39-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 125

HMRbase accession number	10822
Swiss-prot Accession number	P69047 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Chrysemys dorbigni (Black-bellied slider turtle) (Trachemys dorbigni)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 1808015
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 126

HMRbase accession number	10823
Swiss-prot Accession number	P69047 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Chrysemys dorbigni (Black-bellied slider turtle) (Trachemys dorbigni)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 1808015
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 127

HMRbase accession number	10824
Swiss-prot Accession number	P01313 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cricetulus longicaudatus (Long-tailed hamster) (Chinese hamster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Cricetulus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12268
References	1  PubMed abstract 6365663 2   Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.; "Structure of hamster insulin: comparison with a tumor insulin."; Fed. Proc. 32:300-300(1973).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 128

HMRbase accession number	10825
Swiss-prot Accession number	P01313 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cricetulus longicaudatus (Long-tailed hamster) (Chinese hamster)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Cricetulus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12268
References	1  PubMed abstract 6365663 2   Neelon F.A., Delcher H.K., Steinman H., Lebovitz H.E.; "Structure of hamster insulin: comparison with a tumor insulin."; Fed. Proc. 32:300-300(1973).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 129

HMRbase accession number	10826
Swiss-prot Accession number	P01334 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Crotalus atrox (Western diamondback rattlesnake)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Serpentes; Colubroidea;Viperidae; Crotalinae; Crotalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5794
References	1  PubMed abstract 939409
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	APNQRLCGSHLVEALFLICGERGFYYSPRS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 130

HMRbase accession number	10827
Swiss-prot Accession number	P01334 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Crotalus atrox (Western diamondback rattlesnake)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Serpentes; Colubroidea;Viperidae; Crotalinae; Crotalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5794
References	1  PubMed abstract 939409
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCENTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 131

HMRbase accession number	10828
Swiss-prot Accession number	P01335 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cyprinus carpio (Common carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11821
References	1  PubMed abstract 6306593 2  PubMed abstract 7037403
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	NAGAPQHLCGSHLVDALYLVCGPTGFFYNP
Position of mature hormone in Pre-Hormone protein	30 Residues from position (22-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 132

HMRbase accession number	10829
Swiss-prot Accession number	P01335 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Cyprinus carpio (Common carp)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11821
References	1  PubMed abstract 6306593 2  PubMed abstract 7037403
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCSIFELQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 133

HMRbase accession number	10830
Swiss-prot Accession number	O73727 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Danio rerio (Zebrafish) (Brachydanio rerio)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11904
References	1  PubMed abstract 9492081 2   Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	NPGTPQHLCGSHLVDALYLVCGPTGFFYNP
Position of mature hormone in Pre-Hormone protein	30 Residues from position (22-51)
Receptor	N/A
Gene ID	30262
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 134

HMRbase accession number	10831
Swiss-prot Accession number	O73727 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Danio rerio (Zebrafish) (Brachydanio rerio)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11904
References	1  PubMed abstract 9492081 2   Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCSIFELQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	30262
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 135

HMRbase accession number	10832
Swiss-prot Accession number	P18109 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Didelphis marsupialis virginiana (North American opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Didelphis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5732
References	1  PubMed abstract 2695899
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	LVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 136

HMRbase accession number	10833
Swiss-prot Accession number	P18109 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Didelphis marsupialis virginiana (North American opossum)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Didelphis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5732
References	1  PubMed abstract 2695899
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCNSICSLYQLETYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 137

HMRbase accession number	10834
Swiss-prot Accession number	P01316 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Elephas maximus (Indian elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Elephas.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5752
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 138

HMRbase accession number	10835
Swiss-prot Accession number	P01316 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Elephas maximus (Indian elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Elephas.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5752
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTGVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 139

HMRbase accession number	10836
Swiss-prot Accession number	P06306 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12069
References	1   Okamoto S., Morimatsu M.; "Cat insulin."; Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 3518635
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	493804
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 140

HMRbase accession number	10837
Swiss-prot Accession number	P06306 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Felis silvestris catus (Cat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12069
References	1   Okamoto S., Morimatsu M.; "Cat insulin."; Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 3518635
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLEHYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	493804
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 141

HMRbase accession number	10838
Swiss-prot Accession number	P01336 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Gadus callarias (Baltic cod)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Gadiformes; Gadidae; Gadus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5789
References	1  PubMed abstract 4881974 2  PubMed abstract 4866431
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	MAPPQHLCGSHLVDALYLVCGDRGFFYNPK
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 142

HMRbase accession number	10839
Swiss-prot Accession number	P01336 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Gadus callarias (Baltic cod)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Gadiformes; Gadidae; Gadus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5789
References	1  PubMed abstract 4881974 2  PubMed abstract 4866431
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCHRPCDIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 143

HMRbase accession number	10840
Swiss-prot Accession number	P01310 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9147
References	1  PubMed abstract 13373434 2  PubMed abstract 4640931
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 144

HMRbase accession number	10841
Swiss-prot Accession number	P01310 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	86 Amino acids
Molecular weight	9147
References	1  PubMed abstract 13373434 2  PubMed abstract 4640931
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTGICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (66-86)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 145

HMRbase accession number	10842
Swiss-prot Accession number	P68992 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3780981 2  PubMed abstract 2646172
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VPTQRLCGSHLVDALYFVCGERGFFYSPKPIRELEPLL
Position of mature hormone in Pre-Hormone protein	38 Residues from position (1-38)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 146

HMRbase accession number	10843
Swiss-prot Accession number	P68992 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3780981 2  PubMed abstract 2646172
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLANLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (39-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 147

HMRbase accession number	10844
Swiss-prot Accession number	P01328 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hystrix cristata (Crested porcupine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Hystricidae; Hystrix.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5706
References	1  PubMed abstract 6995860
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGNDGFFYRPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 148

HMRbase accession number	10845
Swiss-prot Accession number	P01328 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hystrix cristata (Crested porcupine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Hystricidae; Hystrix.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5706
References	1  PubMed abstract 6995860
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTGVCSLYQLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 149

HMRbase accession number	10846
Swiss-prot Accession number	P01340 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Katsuwonus pelamis (Skipjack tuna) (Bonito)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Katsuwonus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5698
References	1  PubMed abstract 14035061 2  PubMed abstract 14036898
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANPHLCGSHLVEALYLVCGERGFFYQPK
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	2G56
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 150

HMRbase accession number	10847
Swiss-prot Accession number	P01340 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Katsuwonus pelamis (Skipjack tuna) (Bonito)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Katsuwonus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5698
References	1  PubMed abstract 14035061 2  PubMed abstract 14036898
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIHZZCCHKPCBIFZLZBYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	2G56
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 151

HMRbase accession number	10848
Swiss-prot Accession number	P68988 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lampetra fluviatilis (River lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 8575665
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRKCSIYDMENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (37-57)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 152

HMRbase accession number	10849
Swiss-prot Accession number	P09476 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lepisosteus spatula (Alligator gar) (Atractosteus spatula)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Semionotiformes; Lepisosteidae;Lepisosteus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5865
References	1  PubMed abstract 3311873
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGEKGFFYNPNKV
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 153

HMRbase accession number	10850
Swiss-prot Accession number	P09476 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lepisosteus spatula (Alligator gar) (Atractosteus spatula)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Semionotiformes; Lepisosteidae;Lepisosteus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5865
References	1  PubMed abstract 3311873
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCTIYELENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (32-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 154

HMRbase accession number	10851
Swiss-prot Accession number	P69045 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Lophius americanus (American goosefish) (Anglerfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	116 Amino acids
Molecular weight	12737
References	1  PubMed abstract 7001633
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VAPAQHLCGSHLVDALYLVCGDRGFFYNP
Position of mature hormone in Pre-Hormone protein	29 Residues from position (25-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 155

HMRbase accession number	10852
Swiss-prot Accession number	P69045 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Lophius americanus (American goosefish) (Anglerfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	116 Amino acids
Molecular weight	12737
References	1  PubMed abstract 7001633
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (96-116)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 156

HMRbase accession number	10853
Swiss-prot Accession number	P69046 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lophius piscatorius (Allmouth goosefish) (Anglerfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5744
References	1  PubMed abstract 5389298
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VAPAQHLCGSHLVDALYLVCGDRGFFYNPK
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 157

HMRbase accession number	10854
Swiss-prot Accession number	P69046 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Lophius piscatorius (Allmouth goosefish) (Anglerfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5744
References	1  PubMed abstract 5389298
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 158

HMRbase accession number	10855
Swiss-prot Accession number	P30406 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11991
References	1  PubMed abstract 6184262
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 159

HMRbase accession number	10856
Swiss-prot Accession number	P30406 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11991
References	1  PubMed abstract 6184262
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 160

HMRbase accession number	10857
Swiss-prot Accession number	P67968 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Meleagris gallopavo (Common turkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 5066110
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 161

HMRbase accession number	10858
Swiss-prot Accession number	P67968 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Meleagris gallopavo (Common turkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 5066110
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 162

HMRbase accession number	10859
Swiss-prot Accession number	P01330 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Myocastor coypus (Coypu) (Nutria)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Myocastoridae; Myocastor.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5897
References	1   Smith L.F.; "Amino acid sequences of insulins."; Diabetes 21 Suppl. 2:457-460(1972). 2  PubMed abstract 3541911
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	YVSQRLCGSQLVDTLYSVCRHRGFYRPNDG
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 163

HMRbase accession number	10860
Swiss-prot Accession number	P01330 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Myocastor coypus (Coypu) (Nutria)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Myocastoridae; Myocastor.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5897
References	1   Smith L.F.; "Amino acid sequences of insulins."; Diabetes 21 Suppl. 2:457-460(1972). 2  PubMed abstract 3541911
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTNICSRNQLMSYCND
Position of mature hormone in Pre-Hormone protein	22 Residues from position (30-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 164

HMRbase accession number	10861
Swiss-prot Accession number	P07453 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5683
References	1  PubMed abstract 3525155
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	ADPQHLCGSHLVDALYLVCGDRGFFYNPK
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 165

HMRbase accession number	10862
Swiss-prot Accession number	P07453 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Myoxocephalus scorpius (Shorthorn sculpin) (Daddy sculpin)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5683
References	1  PubMed abstract 3525155
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRPCNIRVLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 166

HMRbase accession number	10863
Swiss-prot Accession number	P01342 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12615
References	1  PubMed abstract 6265453 2  PubMed abstract 1097441 3  PubMed abstract 4418746 4  PubMed abstract 4427361
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	RTTGHLCGKDLVNALYIACGVRGFFYDPTKM
Position of mature hormone in Pre-Hormone protein	30 Residues from position (27-57)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 167

HMRbase accession number	10864
Swiss-prot Accession number	P01342 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12615
References	1  PubMed abstract 6265453 2  PubMed abstract 1097441 3  PubMed abstract 4418746 4  PubMed abstract 4427361
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKRCSIYDLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (95-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 168

HMRbase accession number	10865
Swiss-prot Accession number	P17715 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Octodon degus (Degu)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Octodontidae; Octodon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	109 Amino acids
Molecular weight	12197
References	1  PubMed abstract 2293024 2  PubMed abstract 2192710
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	YSSQHLCGSNLVEALYMTCGRSGFYRPHD
Position of mature hormone in Pre-Hormone protein	29 Residues from position (25-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 169

HMRbase accession number	10866
Swiss-prot Accession number	P17715 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Octodon degus (Degu)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Octodontidae; Octodon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	109 Amino acids
Molecular weight	12197
References	1  PubMed abstract 2293024 2  PubMed abstract 2192710
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCNNICTFNQLQNYCNVP
Position of mature hormone in Pre-Hormone protein	23 Residues from position (87-109)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 170

HMRbase accession number	10867
Swiss-prot Accession number	P68989 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5576
References	1   Rusakov Y.I., Karasev V.S., Pertseva M.N., Pankov Y.A.; "Amino acid sequence of humpback salmon (Oncorhynchus gorbuscha)insulin."; Biokhimiia 52:247-254(1987). 2  PubMed abstract 2184990
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AAAQHLCGSHLVDALYLVCGEKGFFYNPK
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 171

HMRbase accession number	10868
Swiss-prot Accession number	P68989 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5576
References	1   Rusakov Y.I., Karasev V.S., Pertseva M.N., Pankov Y.A.; "Amino acid sequence of humpback salmon (Oncorhynchus gorbuscha)insulin."; Biokhimiia 52:247-254(1987). 2  PubMed abstract 2184990
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 172

HMRbase accession number	10869
Swiss-prot Accession number	P04667 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11714
References	1  PubMed abstract 2757686 2   Sorokin A.V., Skoblov Y.S., Mironov A.A., Zlochevskii M.L.,Dem'Yanova N.G., Rebentish B.A., Kozlov Y.I., Kavsan V.M., Sova V.V.,Debabov V.G.; "Nucleotide sequence of cloned insulin cDNA of Oncorhyncus keta."; Dokl. Biochem. 269:80-83(1983). 3  PubMed abstract 6897724 4   Dem'Yanova N.G., Zlochevskii M.L., Kavsan V.M., Kozlov Y.I.,Petrenko A.I., Polyakova N.E., Prokopenko I.V., Rebentish B.A.,Ryndich A.V., Skoblov Y.S., Sova V.V., Yurin V.L., Yankovskii N.K.,Debabov V.G.; "Cloning of the insulin gene of a fish (Oncorhynchus keta) inEscherichia coli."; Dokl. Biochem. 256:35-38(1981). 5  PubMed abstract 3314270
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AAAQHLCGSHLVDALYLVCGEKGFFYTP
Position of mature hormone in Pre-Hormone protein	28 Residues from position (23-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 173

HMRbase accession number	10870
Swiss-prot Accession number	P04667 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11714
References	1  PubMed abstract 2757686 2   Sorokin A.V., Skoblov Y.S., Mironov A.A., Zlochevskii M.L.,Dem'Yanova N.G., Rebentish B.A., Kozlov Y.I., Kavsan V.M., Sova V.V.,Debabov V.G.; "Nucleotide sequence of cloned insulin cDNA of Oncorhyncus keta."; Dokl. Biochem. 269:80-83(1983). 3  PubMed abstract 6897724 4   Dem'Yanova N.G., Zlochevskii M.L., Kavsan V.M., Kozlov Y.I.,Petrenko A.I., Polyakova N.E., Prokopenko I.V., Rebentish B.A.,Ryndich A.V., Skoblov Y.S., Sova V.V., Yurin V.L., Yankovskii N.K.,Debabov V.G.; "Cloning of the insulin gene of a fish (Oncorhynchus keta) inEscherichia coli."; Dokl. Biochem. 256:35-38(1981). 5  PubMed abstract 3314270
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (85-105)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 174

HMRbase accession number	10871
Swiss-prot Accession number	P68990 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus kisutch (Coho salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5576
References	1  PubMed abstract 3898237
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AAAQHLCGSHLVDALYLVCGEKGFFYNPK
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 175

HMRbase accession number	10872
Swiss-prot Accession number	P68990 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Oncorhynchus kisutch (Coho salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5576
References	1  PubMed abstract 3898237
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 176

HMRbase accession number	10873
Swiss-prot Accession number	P30410 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12025
References	1  PubMed abstract 1560757 2  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	449570
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 177

HMRbase accession number	10874
Swiss-prot Accession number	P30410 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12025
References	1  PubMed abstract 1560757 2  PubMed abstract 12952878
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	449570
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 178

HMRbase accession number	10875
Swiss-prot Accession number	P68987 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 3282977
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	SALTGAGGTHLCGSHLVEALYVVCGDRGFFYTPSKT
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 179

HMRbase accession number	10876
Swiss-prot Accession number	P68987 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 3282977
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRKCSIYDMENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (37-57)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 180

HMRbase accession number	10877
Swiss-prot Accession number	P67974 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 13373434 2  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 181

HMRbase accession number	10878
Swiss-prot Accession number	P67974 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Physeter catodon (Sperm whale) (Physeter macrocephalus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5766
References	1  PubMed abstract 13373434 2  PubMed abstract 13552701
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 182

HMRbase accession number	10879
Swiss-prot Accession number	P01315 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11672
References	1   Han X.G., Tuch B.E.; "Complete porcine preproinsulin cDNA sequence."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 12140686 3  PubMed abstract 14574411 4  PubMed abstract 5657063 5   Chance R.E.; Submitted (JUL-1970) to the PIR data bank. 6   Blundell T.L., Dodson G.G., Hodgkin D., Mercola D.; "Insulin. The structure in the crystal and its reflection in chemistryand biology."; Adv. Protein Chem. 26:279-402(1972). 7   Isaacs N.W., Agarwal R.C.; "Experience with fast Fourier least squares in the refinement of thecrystal structure of rhombohedral 2-zinc insulin at 1.5-Aresolution."; Acta Crystallogr. A 34:782-791(1978). 8  PubMed abstract 2905485 9  PubMed abstract 1772633 10  PubMed abstract 2025410 11  PubMed abstract 15299880
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	397415
PDB ID	1B17   1B18   1B19   1B2A   1B2B   1B2C   1B2D   1B2E   1B2F   1B2G   1DEI   1IZA   1IZB   1M5A   1MPJ   1SDB   1WAV   1ZEI   1ZNI   2EFA   2G4M   2TCI   3INS   3MTH   4INS   6INS   7INS   9INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 183

HMRbase accession number	10880
Swiss-prot Accession number	P01315 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11672
References	1   Han X.G., Tuch B.E.; "Complete porcine preproinsulin cDNA sequence."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 12140686 3  PubMed abstract 14574411 4  PubMed abstract 5657063 5   Chance R.E.; Submitted (JUL-1970) to the PIR data bank. 6   Blundell T.L., Dodson G.G., Hodgkin D., Mercola D.; "Insulin. The structure in the crystal and its reflection in chemistryand biology."; Adv. Protein Chem. 26:279-402(1972). 7   Isaacs N.W., Agarwal R.C.; "Experience with fast Fourier least squares in the refinement of thecrystal structure of rhombohedral 2-zinc insulin at 1.5-Aresolution."; Acta Crystallogr. A 34:782-791(1978). 8  PubMed abstract 2905485 9  PubMed abstract 1772633 10  PubMed abstract 2025410 11  PubMed abstract 15299880
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	397415
PDB ID	1B17   1B18   1B19   1B2A   1B2B   1B2C   1B2D   1B2E   1B2F   1B2G   1DEI   1IZA   1IZB   1M5A   1MPJ   1SDB   1WAV   1ZEI   1ZNI   2EFA   2G4M   2TCI   3INS   3MTH   4INS   6INS   7INS   9INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 184

HMRbase accession number	10881
Swiss-prot Accession number	P09477 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5755
References	1  PubMed abstract 3556313
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VVPPQHLCGAHLVDALYLVCGERGFFYTPK
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 185

HMRbase accession number	10882
Swiss-prot Accession number	P09477 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Platichthys flesus (European flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Platichthys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5755
References	1  PubMed abstract 3556313
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 186

HMRbase accession number	10883
Swiss-prot Accession number	P0C236 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Polypterus senegalus (Senegal bichir)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Polypteriformes; Polypteridae; Polypterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5817
References	1  PubMed abstract 9446726
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANRHLCGSHLVEALYLVCGNRGFFYIPSKM
Position of mature hormone in Pre-Hormone protein	31 Residues from position (1-31)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 187

HMRbase accession number	10884
Swiss-prot Accession number	P0C236 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Polypterus senegalus (Senegal bichir)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Polypteriformes; Polypteridae; Polypterus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	52 Amino acids
Molecular weight	5817
References	1  PubMed abstract 9446726
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCDTPCSLYDPENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (32-52)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 188

HMRbase accession number	10885
Swiss-prot Accession number	P01331 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Proechimys guairae (Casiragua)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Echimyidae; Proechimys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5707
References	1  PubMed abstract 16068186
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	YVGQRLCGSQLVDTLYSVCKHRGFYRPSE
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 189

HMRbase accession number	10886
Swiss-prot Accession number	P01331 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Proechimys guairae (Casiragua)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Echimyidae; Proechimys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5707
References	1  PubMed abstract 16068186
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVDQCCTNICSRNQLLTYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 190

HMRbase accession number	10887
Swiss-prot Accession number	P01311 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11838
References	1  PubMed abstract 8132571 2  PubMed abstract 5949593 3   Giddings S.J., Carnaghi L.R., Devaskar S.U.; Submitted (APR-1991) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	100009181
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 191

HMRbase accession number	10888
Swiss-prot Accession number	P01311 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Oryctolagus cuniculus (Rabbit)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11838
References	1  PubMed abstract 8132571 2  PubMed abstract 5949593 3   Giddings S.J., Carnaghi L.R., Devaskar S.U.; Submitted (APR-1991) to the EMBL/GenBank/DDBJ databases.
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	N/A
Gene ID	100009181
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 192

HMRbase accession number	10889
Swiss-prot Accession number	P21563 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Rodentia sp.
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;unclassified rodents.
Subcellular location	Secreted. Note=Stored in spherulous cells prior to secretion
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11849
References	1  PubMed abstract 2531072 2   Bairoch A., Duret L.; Unpublished observations (FEB-1996). 3   Mueller W.E.G.; Unpublished observations (APR-1996).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYILVCGERGFFYTPMS
Position of mature hormone in Pre-Hormone protein	31 Residues from position (24-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 193

HMRbase accession number	10890
Swiss-prot Accession number	P21563 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Rodentia sp.
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;unclassified rodents.
Subcellular location	Secreted. Note=Stored in spherulous cells prior to secretion
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11849
References	1  PubMed abstract 2531072 2   Bairoch A., Duret L.; Unpublished observations (FEB-1996). 3   Mueller W.E.G.; Unpublished observations (APR-1996).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	IVQQCTSGICSLYQENYCN
Position of mature hormone in Pre-Hormone protein	19 Residues from position (90-108)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 194

HMRbase accession number	10891
Swiss-prot Accession number	P67971 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Saimiri sciureus (Common squirrel monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5747
References	1  PubMed abstract 2263627
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGPHLVEALYLVCGERGFFYAPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 195

HMRbase accession number	10892
Swiss-prot Accession number	P67971 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Saimiri sciureus (Common squirrel monkey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Platyrrhini; Cebidae; Saimiriinae; Saimiri.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5747
References	1  PubMed abstract 2263627
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GVVDQCCTSICSLYQLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 196

HMRbase accession number	10893
Swiss-prot Accession number	P51463 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain](Fragment).
Source organism	Selasphorus rufus (Hummingbird)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Trochiliformes; Trochilidae; Selasphorus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	103 Amino acids
Molecular weight	11378
References	1  PubMed abstract 8405887
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AVNQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (21-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 197

HMRbase accession number	10894
Swiss-prot Accession number	P51463 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain](Fragment).
Source organism	Selasphorus rufus (Hummingbird)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Trochiliformes; Trochilidae; Selasphorus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	103 Amino acids
Molecular weight	11378
References	1  PubMed abstract 8405887
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (83-103)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 198

HMRbase accession number	10895
Swiss-prot Accession number	P01318 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11235
References	1  PubMed abstract 8011164 2  PubMed abstract 13249948 3  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 199

HMRbase accession number	10896
Swiss-prot Accession number	P01318 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11235
References	1  PubMed abstract 8011164 2  PubMed abstract 13249948 3  PubMed abstract 4626369
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCAGVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (85-105)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 200

HMRbase accession number	10897
Swiss-prot Accession number	P12704 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Squalus acanthias (Spiny dogfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	54 Amino acids
Molecular weight	6094
References	1  PubMed abstract 6352261
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	LPSQHLCGSHLVEALYFVCGPKGFYYLPKBZV
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 201

HMRbase accession number	10898
Swiss-prot Accession number	P12704 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Squalus acanthias (Spiny dogfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	54 Amino acids
Molecular weight	6094
References	1  PubMed abstract 6352261
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEHCCHNTCSLYDLEGYCNQ
Position of mature hormone in Pre-Hormone protein	22 Residues from position (33-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 202

HMRbase accession number	10899
Swiss-prot Accession number	P67969 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 3045031
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 203

HMRbase accession number	10900
Swiss-prot Accession number	P67969 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 3045031
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 204

HMRbase accession number	10901
Swiss-prot Accession number	P12705 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain](Fragments).
Source organism	Torpedo marmorata (Marbled electric ray)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Torpediniformes; Torpedinoidei; Torpedinidae; Torpedo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	70 Amino acids
Molecular weight	7663
References	1  PubMed abstract 3549433
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	LPSQHLCGSHLVEALYFVCGPKGFYYLPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 205

HMRbase accession number	10902
Swiss-prot Accession number	P12705 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain](Fragments).
Source organism	Torpedo marmorata (Marbled electric ray)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Torpediniformes; Torpedinoidei; Torpedinidae; Torpedo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	70 Amino acids
Molecular weight	7663
References	1  PubMed abstract 3549433
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEHCCHNTCSLFDLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (50-70)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 206

HMRbase accession number	10903
Swiss-prot Accession number	P69048 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 1974347
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 207

HMRbase accession number	10904
Swiss-prot Accession number	P69048 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 1974347
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 208

HMRbase accession number	10905
Swiss-prot Accession number	Q9W7R2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12608
References	1   Andoh T., Nagasawa H.; "Two molecular forms of insulin from barfin flounder, Verasper moseri,are derived from a single gene."; Zool. Sci. 15:931-937(1998).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (95-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 209

HMRbase accession number	10906
Swiss-prot Accession number	P12708 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Zaocys dhumnades (Cantor)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Serpentes; Colubroidea;Colubridae; Colubridae incertae sedis; Zaocys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5809
References	1  PubMed abstract 7029709
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	APNQRLCGSHLVEALFLICGERGFYYSPRT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 210

HMRbase accession number	10907
Swiss-prot Accession number	P12708 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Zaocys dhumnades (Cantor)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Serpentes; Colubroidea;Colubridae; Colubridae incertae sedis; Zaocys.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5809
References	1  PubMed abstract 7029709
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCENTCSLYELENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 211

HMRbase accession number	10908
Swiss-prot Accession number	P01337 (Sequence in FASTA format)
Description	Insulin-1.
Source organism	Batrachoididae sp. (Toadfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Batrachoididae.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5776
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin-1
Mature Hormone Sequence	MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVEQCCHRPCDIFDLQSYCN
Position of mature hormone in Pre-Hormone protein	51 Residues from position (1-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 212

HMRbase accession number	10909
Swiss-prot Accession number	P01325 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	12160
References	1  PubMed abstract 3104603 2  PubMed abstract 2397023 3  PubMed abstract 16141072 4  PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-1 B chain
Mature Hormone Sequence	FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	16333
PDB ID	1L6Q
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 213

HMRbase accession number	10910
Swiss-prot Accession number	P01325 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	12160
References	1  PubMed abstract 3104603 2  PubMed abstract 2397023 3  PubMed abstract 16141072 4  PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-1 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (88-108)
Receptor	N/A
Gene ID	16333
PDB ID	1L6Q
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 214

HMRbase accession number	10911
Swiss-prot Accession number	P01338 (Sequence in FASTA format)
Description	Insulin 2 [Contains: Insulin B chain; Insulin A chain].
Source organism	Batrachoididae sp. (Toadfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Batrachoididae.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5652
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	MAPPQHLCGSHLVDALYLVCGDRGFFYNS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 215

HMRbase accession number	10912
Swiss-prot Accession number	P01338 (Sequence in FASTA format)
Description	Insulin 2 [Contains: Insulin B chain; Insulin A chain].
Source organism	Batrachoididae sp. (Toadfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Batrachoididae.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	50 Amino acids
Molecular weight	5652
References	1  PubMed abstract 5949593
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRPCDKFDLQSYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (30-50)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 216

HMRbase accession number	10913
Swiss-prot Accession number	P01339 (Sequence in FASTA format)
Description	Insulin 2 [Contains: Insulin B chain; Insulin A chain].
Source organism	Thunnus thynnus (Bluefin tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5742
References	1  PubMed abstract 5406482 2   Neumann P.A., Humbel R.E.; Submitted (AUG-1970) to the PIR data bank.
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VAPPQHLCGSHLVDALYLVCGDRGFFYNPK
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 217

HMRbase accession number	10914
Swiss-prot Accession number	P01339 (Sequence in FASTA format)
Description	Insulin 2 [Contains: Insulin B chain; Insulin A chain].
Source organism	Thunnus thynnus (Bluefin tuna)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Scombroidei;Scombridae; Thunnus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5742
References	1  PubMed abstract 5406482 2   Neumann P.A., Humbel R.E.; Submitted (AUG-1970) to the PIR data bank.
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 218

HMRbase accession number	11208
Swiss-prot Accession number	P51454 (Sequence in FASTA format)
Description	Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed in the corpus luteum of pregnancy but not in the placenta
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	166 Amino acids
Molecular weight	18731
References	1  PubMed abstract 8182365
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	DSWMDEVIKLCGRELVRAQIAICGMSTWS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (6-34)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 219

HMRbase accession number	11209
Swiss-prot Accession number	P51454 (Sequence in FASTA format)
Description	Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed in the corpus luteum of pregnancy but not in the placenta
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	166 Amino acids
Molecular weight	18731
References	1  PubMed abstract 8182365
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QPYVALFEKCCLIGCTKRSLANYC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (143-166)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 220

HMRbase accession number	11210
Swiss-prot Accession number	P01347 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	186 Amino acids
Molecular weight	20489
References	1  PubMed abstract 7231533 2  PubMed abstract 14659888 3  PubMed abstract 7004862
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL
Position of mature hormone in Pre-Hormone protein	35 Residues from position (23-57)
Receptor	N/A
Gene ID	25616
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 221

HMRbase accession number	11211
Swiss-prot Accession number	P01347 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	186 Amino acids
Molecular weight	20489
References	1  PubMed abstract 7231533 2  PubMed abstract 14659888 3  PubMed abstract 7004862
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QSGALLSEQCCHIGCTRRSIAKLC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (163-186)
Receptor	N/A
Gene ID	25616
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 222

HMRbase accession number	11212
Swiss-prot Accession number	P51455 (Sequence in FASTA format)
Description	Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed in the corpus luteum of pregnancy and in the placenta
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	166 Amino acids
Molecular weight	18761
References	1  PubMed abstract 8182365 2  PubMed abstract 8735594
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	DSWMDEVIKLCGRELVRAQIAICGKSTWS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (6-34)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 223

HMRbase accession number	11213
Swiss-prot Accession number	P51455 (Sequence in FASTA format)
Description	Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain](Fragment).
Source organism	Pan troglodytes (Chimpanzee)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Expressed in the corpus luteum of pregnancy and in the placenta
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	166 Amino acids
Molecular weight	18761
References	1  PubMed abstract 8182365 2  PubMed abstract 8735594
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QLYSALANKCCHVGCTKRSLARFC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (143-166)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 224

HMRbase accession number	11214
Swiss-prot Accession number	P11184 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6098
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSTNDLIKACGRELVRLWVEICGSVRWGQSAL
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 225

HMRbase accession number	11215
Swiss-prot Accession number	P11184 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera acutorostrata (Minke whale) (Lesser rorqual)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6098
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	RMTLSEKCCQVGCIRKDIARLC
Position of mature hormone in Pre-Hormone protein	22 Residues from position (33-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 226

HMRbase accession number	11216
Swiss-prot Accession number	P11185 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Balaenoptera edeni (Pigmy Bryde's whale)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	54 Amino acids
Molecular weight	6071
References	1  PubMed abstract 2910872
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSTNDLIKACGRELVRLWVEICGSVSWGRTAL
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 227

HMRbase accession number	11217
Swiss-prot Accession number	P22969 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20721
References	1   Min K., Shiota K., Ogawa T.; "Molecular cloning of equine preprorelaxin cDNA."; J. Reprod. Dev. 42:171-178(1996). 2  PubMed abstract 7543295 3  PubMed abstract 2055195
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QKPDDVIKACGRELARLRIEICGSLSWK
Position of mature hormone in Pre-Hormone protein	28 Residues from position (26-53)
Receptor	N/A
Gene ID	100033823
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 228

HMRbase accession number	11218
Swiss-prot Accession number	P22969 (Sequence in FASTA format)
Description	Prorelaxin precursor (RXN) [Contains: Relaxin B chain; Relaxin Achain].
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20721
References	1   Min K., Shiota K., Ogawa T.; "Molecular cloning of equine preprorelaxin cDNA."; J. Reprod. Dev. 42:171-178(1996). 2  PubMed abstract 7543295 3  PubMed abstract 2055195
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QLSHKCCYWGCTRKELARQC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (163-182)
Receptor	N/A
Gene ID	100033823
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 229

HMRbase accession number	11219
Swiss-prot Accession number	P19884 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	20895
References	1  PubMed abstract 2590381
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	AKWMDDVIKACGRELVRAQIAICGKSTLG
Position of mature hormone in Pre-Hormone protein	29 Residues from position (25-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 230

HMRbase accession number	11220
Swiss-prot Accession number	P19884 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Macaca mulatta (Rhesus macaque)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	20895
References	1  PubMed abstract 2590381
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QLYMTLSNKCCHIGCTKKSLAKFC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (162-185)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 231

HMRbase accession number	11221
Swiss-prot Accession number	P01348 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20818
References	1  PubMed abstract 6897721 2  PubMed abstract 2442155 3  PubMed abstract 876374 4  PubMed abstract 851452 5  PubMed abstract 843375 6  PubMed abstract 938497 7  PubMed abstract 887933 8  PubMed abstract 622170
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSTNDFIKACGRELVRLWVEICGSVSWGRTAL
Position of mature hormone in Pre-Hormone protein	32 Residues from position (25-56)
Receptor	N/A
Gene ID	396891
PDB ID	1RLX   2RLX   3RLX   4RLX
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 232

HMRbase accession number	11222
Swiss-prot Accession number	P01348 (Sequence in FASTA format)
Description	Prorelaxin precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	182 Amino acids
Molecular weight	20818
References	1  PubMed abstract 6897721 2  PubMed abstract 2442155 3  PubMed abstract 876374 4  PubMed abstract 851452 5  PubMed abstract 843375 6  PubMed abstract 938497 7  PubMed abstract 887933 8  PubMed abstract 622170
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	RMTLSEKCCQVGCIRKDIARLC
Position of mature hormone in Pre-Hormone protein	22 Residues from position (161-182)
Receptor	N/A
Gene ID	396891
PDB ID	1RLX   2RLX   3RLX   4RLX
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 233

HMRbase accession number	11223
Swiss-prot Accession number	P11952 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Raja erinacea (Little skate)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Rajiformes; Rajidae; Leucoraja.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	64 Amino acids
Molecular weight	7499
References	1  PubMed abstract 3827922
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	RPNWEERSRLCGRDLIRAFIYLCGGTRWTRLPNFGNYPIM
Position of mature hormone in Pre-Hormone protein	40 Residues from position (1-40)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 234

HMRbase accession number	11224
Swiss-prot Accession number	P11952 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Raja erinacea (Little skate)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Rajiformes; Rajidae; Leucoraja.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	64 Amino acids
Molecular weight	7499
References	1  PubMed abstract 3827922
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	EEKMGFAKKCCAIGCSTEDFRMVC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (41-64)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 235

HMRbase accession number	11225
Swiss-prot Accession number	P11953 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Squalus acanthias (Spiny dogfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	The function of relaxin in an oviparous species is not yet known
Protein Length	54 Amino acids
Molecular weight	5910
References	1  PubMed abstract 3780747
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	QSFKNAEPGIKLCGREFIRAVIYTCGGSRW
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 236

HMRbase accession number	11226
Swiss-prot Accession number	P11953 (Sequence in FASTA format)
Description	Relaxin [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Squalus acanthias (Spiny dogfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	The function of relaxin in an oviparous species is not yet known
Protein Length	54 Amino acids
Molecular weight	5910
References	1  PubMed abstract 3780747
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	EGSPGMSSKCCTYGCTRKDISILC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (31-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 237

HMRbase accession number	11336
Swiss-prot Accession number	P01308 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 6243748 2  PubMed abstract 6248962 3  PubMed abstract 503234 4  PubMed abstract 6927840 5  PubMed abstract 8358440 6   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases. 7  PubMed abstract 15489334 8   Fajardy I.I., Weill J.J., Stuckens C.C., Danze P.M.P.; "Description of a novel RFLP diallelic polymorphism (-127 BsgI C/G)within the 5' region of insulin gene."; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 14426955 10  PubMed abstract 5101771 11  PubMed abstract 5560404 12  PubMed abstract 4443293 13  PubMed abstract 4803504 14  PubMed abstract 4698555 15  PubMed abstract 4698553 16  PubMed abstract 6312455 17  PubMed abstract 6424111 18  PubMed abstract 3470784 19  PubMed abstract 3537011 20  PubMed abstract 2196279 21  PubMed abstract 4019786 22  PubMed abstract 1601997 23  PubMed abstract 2271664 24  PubMed abstract 2036420 25  PubMed abstract 1646635 26  PubMed abstract 1433291 27  PubMed abstract 8421693 28  PubMed abstract 9235985
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P06213    Detail in HMRbase
Gene ID	3630
PDB ID	1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P
Drugpedia	wiki
Comments

Search Result - 238

HMRbase accession number	11337
Swiss-prot Accession number	P01308 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	11981
References	1  PubMed abstract 6243748 2  PubMed abstract 6248962 3  PubMed abstract 503234 4  PubMed abstract 6927840 5  PubMed abstract 8358440 6   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases. 7  PubMed abstract 15489334 8   Fajardy I.I., Weill J.J., Stuckens C.C., Danze P.M.P.; "Description of a novel RFLP diallelic polymorphism (-127 BsgI C/G)within the 5' region of insulin gene."; Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases. 9  PubMed abstract 14426955 10  PubMed abstract 5101771 11  PubMed abstract 5560404 12  PubMed abstract 4443293 13  PubMed abstract 4803504 14  PubMed abstract 4698555 15  PubMed abstract 4698553 16  PubMed abstract 6312455 17  PubMed abstract 6424111 18  PubMed abstract 3470784 19  PubMed abstract 3537011 20  PubMed abstract 2196279 21  PubMed abstract 4019786 22  PubMed abstract 1601997 23  PubMed abstract 2271664 24  PubMed abstract 2036420 25  PubMed abstract 1646635 26  PubMed abstract 1433291 27  PubMed abstract 8421693 28  PubMed abstract 9235985
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P06213    Detail in HMRbase
Gene ID	3630
PDB ID	1A7F   1AI0   1AIY   1B9E   1BEN   1EFE   1EV3   1EV6   1EVR   1FU2   1FUB   1G7A   1G7B   1GUJ   1HIQ   1HIS   1HIT   1HLS   1HTV   1HUI   1IOG   1IOH   1J73   1JCA   1JCO   1K3M   1KMF   1LKQ   1LPH   1MHI   1MHJ   1MSO   1OS3   1OS4   1QIY   1QIZ   1QJ0   1RWE   1SF1   1SJT   1SJU   1T0C   1T1K   1T1P   1T1Q   1TRZ   1TYL   1TYM   1UZ9   1VKT   1W8P
Drugpedia	wiki
Comments

Search Result - 239

HMRbase accession number	11338
Swiss-prot Accession number	P01322 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12421
References	1  PubMed abstract 498283 2  PubMed abstract 498284 3  PubMed abstract 6249167 4  PubMed abstract 4311938 5  PubMed abstract 4640931 6  PubMed abstract 4554104
Domain Name	Insulin
Hormone Name	Insulin-1 B chain
Mature Hormone Sequence	FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P15127    Detail in HMRbase
Gene ID	24505
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 240

HMRbase accession number	11339
Swiss-prot Accession number	P01322 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12421
References	1  PubMed abstract 498283 2  PubMed abstract 498284 3  PubMed abstract 6249167 4  PubMed abstract 4311938 5  PubMed abstract 4640931 6  PubMed abstract 4554104
Domain Name	Insulin
Hormone Name	Insulin-1 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P15127    Detail in HMRbase
Gene ID	24505
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 241

HMRbase accession number	11340
Swiss-prot Accession number	P01323 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12339
References	1  PubMed abstract 498284 2  PubMed abstract 2427930 3  PubMed abstract 6249167 4  PubMed abstract 4311938 5  PubMed abstract 4640931 6  PubMed abstract 4554104
Domain Name	Insulin
Hormone Name	Insulin-2 B chain
Mature Hormone Sequence	FVKQHLCGSHLVEALYLVCGERGFFYTPMS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P15127    Detail in HMRbase
Gene ID	24506
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 242

HMRbase accession number	11341
Swiss-prot Accession number	P01323 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12339
References	1  PubMed abstract 498284 2  PubMed abstract 2427930 3  PubMed abstract 6249167 4  PubMed abstract 4311938 5  PubMed abstract 4640931 6  PubMed abstract 4554104
Domain Name	Insulin
Hormone Name	Insulin-2 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P15127    Detail in HMRbase
Gene ID	24506
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 243

HMRbase accession number	11342
Swiss-prot Accession number	P01326 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12364
References	1  PubMed abstract 3104603 2  PubMed abstract 2397023 3  PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-2 B chain
Mature Hormone Sequence	FVKQHLCGSHLVEALYLVCGERGFFYTPMS
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	P15208    Detail in HMRbase
Gene ID	16334
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 244

HMRbase accession number	11343
Swiss-prot Accession number	P01326 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	110 Amino acids
Molecular weight	12364
References	1  PubMed abstract 3104603 2  PubMed abstract 2397023 3  PubMed abstract 5063718
Domain Name	Insulin
Hormone Name	Insulin-2 A chain
Mature Hormone Sequence	GIVDQCCTSICSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (90-110)
Receptor	P15208    Detail in HMRbase
Gene ID	16334
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 245

HMRbase accession number	11362
Swiss-prot Accession number	P04090 (Sequence in FASTA format)
Description	Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Isoform 1 expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 relatively abundant in placenta, much lower abundance in the prostate gland. Not detected in the ovary
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	21043
References	1  PubMed abstract 6548702 2  PubMed abstract 15164053 3  PubMed abstract 15489334 4  PubMed abstract 8735594 5  PubMed abstract 10601981 6  PubMed abstract 1572287 7  PubMed abstract 2076464 8  PubMed abstract 2040595 9  PubMed abstract 1656049
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	DSWMEEVIKLCGRELVRAQIAICGMSTWS
Position of mature hormone in Pre-Hormone protein	29 Residues from position (25-53)
Receptor	Q9HBX9   Detail in HMRbase    Q8WXD0    Detail in HMRbase
Gene ID	6019
PDB ID	6RLX
Drugpedia	wiki
Comments

Search Result - 246

HMRbase accession number	11363
Swiss-prot Accession number	P04090 (Sequence in FASTA format)
Description	Prorelaxin H2 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Isoform 1 expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 relatively abundant in placenta, much lower abundance in the prostate gland. Not detected in the ovary
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	21043
References	1  PubMed abstract 6548702 2  PubMed abstract 15164053 3  PubMed abstract 15489334 4  PubMed abstract 8735594 5  PubMed abstract 10601981 6  PubMed abstract 1572287 7  PubMed abstract 2076464 8  PubMed abstract 2040595 9  PubMed abstract 1656049
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	QLYSALANKCCHVGCTKRSLARFC
Position of mature hormone in Pre-Hormone protein	24 Residues from position (162-185)
Receptor	Q9HBX9   Detail in HMRbase    Q8WXD0    Detail in HMRbase
Gene ID	6019
PDB ID	6RLX
Drugpedia	wiki
Comments

Search Result - 247

HMRbase accession number	11369
Swiss-prot Accession number	P04808 (Sequence in FASTA format)
Description	Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Prostate. Not expressed in placenta, decidua or ovary
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	21146
References	1  PubMed abstract 6548702 2  PubMed abstract 6298628 3  PubMed abstract 15164053 4  PubMed abstract 15489334 5  PubMed abstract 8735594 6  PubMed abstract 10601981
Domain Name	Insulin
Hormone Name	Relaxin B chain
Mature Hormone Sequence	VAAKWKDDVIKLCGRELVRAQIAICGMSTWS
Position of mature hormone in Pre-Hormone protein	31 Residues from position (23-53)
Receptor	Q9HBX9   Detail in HMRbase    Q8WXD0    Detail in HMRbase
Gene ID	6013
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 248

HMRbase accession number	11370
Swiss-prot Accession number	P04808 (Sequence in FASTA format)
Description	Prorelaxin H1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	Prostate. Not expressed in placenta, decidua or ovary
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix
Protein Length	185 Amino acids
Molecular weight	21146
References	1  PubMed abstract 6548702 2  PubMed abstract 6298628 3  PubMed abstract 15164053 4  PubMed abstract 15489334 5  PubMed abstract 8735594 6  PubMed abstract 10601981
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	PYVALFEKCCLIGCTKRSLAKYC
Position of mature hormone in Pre-Hormone protein	23 Residues from position (163-185)
Receptor	Q9HBX9   Detail in HMRbase    Q8WXD0    Detail in HMRbase
Gene ID	6013
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 249

HMRbase accession number	11402
Swiss-prot Accession number	P12706 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12170
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-1 B chain
Mature Hormone Sequence	LVNQHLCGSHLVEALYLVCGDRGFFYYPKV
Position of mature hormone in Pre-Hormone protein	30 Residues from position (24-53)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378696
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 250

HMRbase accession number	11403
Swiss-prot Accession number	P12706 (Sequence in FASTA format)
Description	Insulin-1 precursor [Contains: Insulin-1 B chain; Insulin-1 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12170
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-1 A chain
Mature Hormone Sequence	GIVEQCCHSTCSLFQLESYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (86-106)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378696
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 251

HMRbase accession number	11404
Swiss-prot Accession number	P12707 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12207
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-2 B chain
Mature Hormone Sequence	LANQHLCGSHLVEALYLVCGDRGFFYYPKI
Position of mature hormone in Pre-Hormone protein	30 Residues from position (24-53)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378695
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 252

HMRbase accession number	11405
Swiss-prot Accession number	P12707 (Sequence in FASTA format)
Description	Insulin-2 precursor [Contains: Insulin-2 B chain; Insulin-2 A chain].
Source organism	Xenopus laevis (African clawed frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	106 Amino acids
Molecular weight	12207
References	1  PubMed abstract 2722842 2  PubMed abstract 2661211
Domain Name	Insulin
Hormone Name	Insulin-2 A chain
Mature Hormone Sequence	GIVEQCCHSTCSLFQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (86-106)
Receptor	Q9PVZ4    Detail in HMRbase
Gene ID	378695
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 253

HMRbase accession number	11462
Swiss-prot Accession number	P47932 (Sequence in FASTA format)
Description	Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin A chain].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals
Protein Length	185 Amino acids
Molecular weight	20571
References	1  PubMed abstract 8452637 2  PubMed abstract 8216305
Domain Name	Insulin
Hormone Name	Relaxin A chain
Mature Hormone Sequence	ESGGLMSQQCCHVGCSRRSIAKLYC
Position of mature hormone in Pre-Hormone protein	25 Residues from position (161-185)
Receptor	Q91ZZ5    Detail in HMRbase
Gene ID	19773
PDB ID	N/A
Drugpedia	wiki
Comments