A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10231
Swiss-prot Accession number	Q9N0V5 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Equus caballus (Horse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	140 Amino acids
Molecular weight	15358
References	1  PubMed abstract 12581884
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (84-115)
Receptor	N/A
Gene ID	100033906
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10296
Swiss-prot Accession number	P01257 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Rattus norvegicus (Rat)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	136 Amino acids
Molecular weight	15103
References	1  PubMed abstract 6264603 2  PubMed abstract 6400492 3  PubMed abstract 6933496 4  PubMed abstract 1278175
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	P32214    Detail in HMRbase
Gene ID	24241
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 3

HMRbase accession number	11028
Swiss-prot Accession number	P01263 (Sequence in FASTA format)
Description	Calcitonin-1 precursor.
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	136 Amino acids
Molecular weight	15179
References	1  PubMed abstract 3691820 2  PubMed abstract 5261048 3  PubMed abstract 5361911 4  PubMed abstract 1991104 5  PubMed abstract 2043752 6  PubMed abstract 1931969
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin-1
Mature Hormone Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (83-114)
Receptor	N/A
Gene ID	N/A
PDB ID	2GLG   2GLH
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11029
Swiss-prot Accession number	P69067 (Sequence in FASTA format)
Description	Calcitonin-2.
Source organism	Oncorhynchus keta (Chum salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3387
References	1   Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972). 2  PubMed abstract 4508400
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin-2
Mature Hormone Sequence	CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	11030
Swiss-prot Accession number	P69068 (Sequence in FASTA format)
Description	Calcitonin-2.
Source organism	Oncorhynchus nerka (Sockeye salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3387
References	1   Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972). 2  PubMed abstract 4508400
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin-2
Mature Hormone Sequence	CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	11031
Swiss-prot Accession number	P01265 (Sequence in FASTA format)
Description	Calcitonin-3.
Source organism	Oncorhynchus kisutch (Coho salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3419
References	1   Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972). 2  PubMed abstract 4508400
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin-3
Mature Hormone Sequence	CSNLSTCMLGKLSQDLHKLQTFPRTNTGAGVP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	11032
Swiss-prot Accession number	P01262 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Anguilla japonica (Japanese eel)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3418
References	1   Noda T., Narita K.; "Amino acid sequence of eel calcitonin."; J. Biochem. 79:353-359(1976). 2  PubMed abstract 10387083
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	1BKU   1BYV   1BZB
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	11033
Swiss-prot Accession number	P01260 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3596
References	1  PubMed abstract 5259773
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWKDLNNYHRFSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11034
Swiss-prot Accession number	P41547 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Canis familiaris (Dog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	Synthesized by C-cells of the thyroid gland
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	130 Amino acids
Molecular weight	14051
References	1  PubMed abstract 10967131 2  PubMed abstract 1758974
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	N/A
Gene ID	403946
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11035
Swiss-prot Accession number	P07660 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Gallus gallus (Chicken)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	138 Amino acids
Molecular weight	15308
References	1  PubMed abstract 3666142 2  PubMed abstract 4054101 3  PubMed abstract 3838160 4  PubMed abstract 3782060
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (82-113)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11036
Swiss-prot Accession number	P01261 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Ovis aries (Sheep)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	143 Amino acids
Molecular weight	15659
References	1  PubMed abstract 8482543 2   Sauer R., Niall H.D., Potts J.T. Jr.; "Accelerated procedures for automated peptide degradation."; Fed. Proc. 29:728-728(1970).
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWKDLNNYHRYSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (87-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	11323
Swiss-prot Accession number	P01258 (Sequence in FASTA format)
Description	Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	141 Amino acids
Molecular weight	15467
References	1  PubMed abstract 6546550 2  PubMed abstract 3872459 3  PubMed abstract 3485540 4  PubMed abstract 3034287 5  PubMed abstract 2571128 6  PubMed abstract 1761559 7   Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 15489334 9  PubMed abstract 2408883 10  PubMed abstract 6148938 11  PubMed abstract 5760861 12  PubMed abstract 2001366 13  PubMed abstract 6132180 14  PubMed abstract 14759258
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	P30988    Detail in HMRbase
Gene ID	796
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 13

HMRbase accession number	11324
Swiss-prot Accession number	P01258 (Sequence in FASTA format)
Description	Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)].
Source organism	Homo sapiens (Human)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Katacalcin is a potent plasma calcium-lowering peptide
Protein Length	141 Amino acids
Molecular weight	15467
References	1  PubMed abstract 6546550 2  PubMed abstract 3872459 3  PubMed abstract 3485540 4  PubMed abstract 3034287 5  PubMed abstract 2571128 6  PubMed abstract 1761559 7   Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 15489334 9  PubMed abstract 2408883 10  PubMed abstract 6148938 11  PubMed abstract 5760861 12  PubMed abstract 2001366 13  PubMed abstract 6132180 14  PubMed abstract 14759258
Domain Name	Calc_CGRP_IAPP
Hormone Name	Katacalcin
Mature Hormone Sequence	DMSSDLERDHRPHVSMPQNAN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (121-141)
Receptor	P30988    Detail in HMRbase
Gene ID	796
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 14

HMRbase accession number	11325
Swiss-prot Accession number	P01259 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Sus scrofa (Pig)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3607
References	1  PubMed abstract 5240032 2  PubMed abstract 5462122 3  PubMed abstract 5693288
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	P25117    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 15

HMRbase accession number	11398
Swiss-prot Accession number	P0C234 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Rana catesbeiana (Bull frog)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3426
References	1  PubMed abstract 9245522
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSGLSTCALMKLSQDLHRFNSYPRTNVGAGTP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	Q7SX84    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11496
Swiss-prot Accession number	P69165 (Sequence in FASTA format)
Description	Calcitonin-2.
Source organism	Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3387
References	1   Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972). 2  PubMed abstract 4508400
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin-2
Mature Hormone Sequence	CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	Q8AXU4    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 17

HMRbase accession number	11497
Swiss-prot Accession number	P70160 (Sequence in FASTA format)
Description	Calcitonin precursor.
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	136 Amino acids
Molecular weight	15141
References	1  PubMed abstract 8806650 2  PubMed abstract 11761712 3  PubMed abstract 15489334
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (85-116)
Receptor	Q60755    Detail in HMRbase
Gene ID	12310
PDB ID	N/A
Drugpedia	wiki
Comments