A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10231 |
Swiss-prot Accession number | Q9N0V5 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Equus caballus (Horse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 140 Amino acids |
Molecular weight | 15358 |
References | 1 PubMed abstract 12581884 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (84-115) |
Receptor | N/A |
Gene ID | 100033906 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10296 |
Swiss-prot Accession number | P01257 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 136 Amino acids |
Molecular weight | 15103 |
References | 1 PubMed abstract 6264603 2 PubMed abstract 6400492 3 PubMed abstract 6933496 4 PubMed abstract 1278175 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
Receptor | P32214
Detail in HMRbase |
Gene ID | 24241 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11028 |
Swiss-prot Accession number | P01263 (Sequence in FASTA format) |
Description | Calcitonin-1 precursor. |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 136 Amino acids |
Molecular weight | 15179 |
References | 1 PubMed abstract 3691820 2 PubMed abstract 5261048 3 PubMed abstract 5361911 4 PubMed abstract 1991104 5 PubMed abstract 2043752 6 PubMed abstract 1931969 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-1 |
Mature Hormone Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (83-114) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | 2GLG 2GLH |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11029 |
Swiss-prot Accession number | P69067 (Sequence in FASTA format) |
Description | Calcitonin-2. |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3387 |
References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-2 |
Mature Hormone Sequence | CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11030 |
Swiss-prot Accession number | P69068 (Sequence in FASTA format) |
Description | Calcitonin-2. |
Source organism | Oncorhynchus nerka (Sockeye salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3387 |
References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-2 |
Mature Hormone Sequence | CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11031 |
Swiss-prot Accession number | P01265 (Sequence in FASTA format) |
Description | Calcitonin-3. |
Source organism | Oncorhynchus kisutch (Coho salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3419 |
References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-3 |
Mature Hormone Sequence | CSNLSTCMLGKLSQDLHKLQTFPRTNTGAGVP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11032 |
Swiss-prot Accession number | P01262 (Sequence in FASTA format) |
Description | Calcitonin. |
Source organism | Anguilla japonica (Japanese eel) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3418 |
References | 1 Noda T., Narita K.; "Amino acid sequence of eel calcitonin."; J. Biochem. 79:353-359(1976).
2 PubMed abstract 10387083 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | 1BKU 1BYV 1BZB |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11033 |
Swiss-prot Accession number | P01260 (Sequence in FASTA format) |
Description | Calcitonin. |
Source organism | Bos taurus (Bovine) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3596 |
References | 1 PubMed abstract 5259773 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLSAYWKDLNNYHRFSGMGFGPETP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11034 |
Swiss-prot Accession number | P41547 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | Synthesized by C-cells of the thyroid gland |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 130 Amino acids |
Molecular weight | 14051 |
References | 1 PubMed abstract 10967131 2 PubMed abstract 1758974 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
Receptor | N/A |
Gene ID | 403946 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11035 |
Swiss-prot Accession number | P07660 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Gallus gallus (Chicken) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 138 Amino acids |
Molecular weight | 15308 |
References | 1 PubMed abstract 3666142 2 PubMed abstract 4054101 3 PubMed abstract 3838160 4 PubMed abstract 3782060 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (82-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11036 |
Swiss-prot Accession number | P01261 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Ovis aries (Sheep) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 143 Amino acids |
Molecular weight | 15659 |
References | 1 PubMed abstract 8482543 2 Sauer R., Niall H.D., Potts J.T. Jr.; "Accelerated procedures for automated peptide degradation."; Fed. Proc. 29:728-728(1970). |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLSAYWKDLNNYHRYSGMGFGPETP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (87-118) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11323 |
Swiss-prot Accession number | P01258 (Sequence in FASTA format) |
Description | Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 141 Amino acids |
Molecular weight | 15467 |
References | 1 PubMed abstract 6546550 2 PubMed abstract 3872459 3 PubMed abstract 3485540 4 PubMed abstract 3034287 5 PubMed abstract 2571128 6 PubMed abstract 1761559 7 Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 15489334 9 PubMed abstract 2408883 10 PubMed abstract 6148938 11 PubMed abstract 5760861 12 PubMed abstract 2001366 13 PubMed abstract 6132180 14 PubMed abstract 14759258 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
Receptor | P30988
Detail in HMRbase |
Gene ID | 796 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11324 |
Swiss-prot Accession number | P01258 (Sequence in FASTA format) |
Description | Calcitonin precursor [Contains: Calcitonin; Katacalcin (Calcitonincarboxyl-terminal peptide) (CCP) (PDN-21)]. |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Katacalcin is a potent plasma calcium-lowering peptide |
Protein Length | 141 Amino acids |
Molecular weight | 15467 |
References | 1 PubMed abstract 6546550 2 PubMed abstract 3872459 3 PubMed abstract 3485540 4 PubMed abstract 3034287 5 PubMed abstract 2571128 6 PubMed abstract 1761559 7 Livingston R.J., Rieder M.J., Shaffer T., Bertucci C., Baier C.N.,Rajkumar N., Willa H.T., Daniels M., Downing T.K., Stanaway I.B.,Nguyen C.P., Gildersleeve H., Cassidy C.M., Johnson E.J.,Swanson J.E., McFarland I., Yool B., Park C., Nickerson D.A.; "NIEHS-SNPs, environmental genome project, NIEHS ES15478, Departmentof Genome Sciences, Seattle, WA (URL: http://egp.gs.washington.edu)."; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases. 8 PubMed abstract 15489334 9 PubMed abstract 2408883 10 PubMed abstract 6148938 11 PubMed abstract 5760861 12 PubMed abstract 2001366 13 PubMed abstract 6132180 14 PubMed abstract 14759258 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Katacalcin |
Mature Hormone Sequence | DMSSDLERDHRPHVSMPQNAN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (121-141) |
Receptor | P30988
Detail in HMRbase |
Gene ID | 796 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11325 |
Swiss-prot Accession number | P01259 (Sequence in FASTA format) |
Description | Calcitonin. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3607 |
References | 1 PubMed abstract 5240032 2 PubMed abstract 5462122 3 PubMed abstract 5693288 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | P25117
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11398 |
Swiss-prot Accession number | P0C234 (Sequence in FASTA format) |
Description | Calcitonin. |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3426 |
References | 1 PubMed abstract 9245522 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CSGLSTCALMKLSQDLHRFNSYPRTNVGAGTP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | Q7SX84
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11496 |
Swiss-prot Accession number | P69165 (Sequence in FASTA format) |
Description | Calcitonin-2. |
Source organism | Oncorhynchus gorbuscha (Pink salmon) (Humpback salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 32 Amino acids |
Molecular weight | 3387 |
References | 1 Keutmann H.T., Lequin R.M., Habener J.F., Singer F.R., Niall H.D.,Potts J.T. Jr.; "Chemistry and physiology of the calcitonins: some recent advances."; (In) Taylor S. (eds.);Endocrinology 1971: proceedings of the third international symposium,pp.316-323, Heinemann Medical Books, London (1972).
2 PubMed abstract 4508400 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin-2 |
Mature Hormone Sequence | CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (1-32) |
Receptor | Q8AXU4
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11497 |
Swiss-prot Accession number | P70160 (Sequence in FASTA format) |
Description | Calcitonin precursor. |
Source organism | Mus musculus (Mouse) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
Protein Length | 136 Amino acids |
Molecular weight | 15141 |
References | 1 PubMed abstract 8806650 2 PubMed abstract 11761712 3 PubMed abstract 15489334 |
Domain Name | Calc_CGRP_IAPP |
Hormone Name | Calcitonin |
Mature Hormone Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (85-116) |
Receptor | Q60755
Detail in HMRbase |
Gene ID | 12310 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |