• Home
• Browse
• Search
• Advanced search
• Blast
• Map
• Negpep
• Modpep
• Update
• Help
• Download
• Authors
• Contact

Browse By

• Peptide Source


• Cell line


• Target


• Assay


• Author
Total number of Results for Synthetic are 235
Results from 0 - 25

« previous12345678910next »

HIPid	Sequence	Length	Source	Cell line	Target	Assay	Reference
HIP1175	ITFEDLLDYYGP	12	Synthetic	MT-2	Virus Assembly	Luciferase assay	18374356
HIP253	KGLSGPSEWWVWV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP256	KGLSGPTAWWVVV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP254	KGLSGPSIRWWLV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP249	KGLSGPFFWWLFV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP258	KGLSGPWCRWWLV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP252	KGLSGPRYVWWLV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP250	KGLSGPGGWWGFV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP255	KGLSGPSWWLFCV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP247	KGLSGPESRWWVV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP248	KGLSGPFCSWWWV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP472	KGLSGPCGWWVWSRGSGK	18	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP257	KGLSGPTVQWWVV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP246	KGLSGPAVPWWVV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP251	KGLSGPQGSWWVV	13	Synthetic	HP16	vpr	Yeast growth arrest	12379652
HIP1169	IYWNVSGW	8	Synthetic	293T	Virus release	Reverse two-hybrid system	19099395
HIP1104	TNWYGSGW	8	Synthetic	293T	Virus release	Reverse two-hybrid system	19099395
HIP1105	TLLVYSGW	8	Synthetic	293T	Virus release	Reverse two-hybrid system	19099395
HIP1170	IYWNVSGW	8	Synthetic	293T	Budding	Reverse two-hybrid system	19053244
HIP1088	ITFEDLLDYYGP	12	Synthetic	NA	Virus Assembly	Electron Microscopy	16041387
HIP926	WQEWEQKITALLEQAQIQQEKNEYELQKLDKWASLWEWF	39	Synthetic	NA	Fusion inhibitor	CD spectra	US7919101
HIP815	HSLIEESQNQQEKNEQELLELDKWASLWNWFNITNW	36	Synthetic	NA	Fusion inhibitor	CD spectra	US7919101
HIP807	EELAKKAEELAKKAEELAKKAEELAKKAWASLWNWF	36	Synthetic	NA	Fusion inhibitor	CD spectra	US7919101
HIP806	EEAAKKLEEAAKKLEEAAKKLEEAAKKLWASLWNWF	36	Synthetic	NA	Fusion inhibitor	CD spectra	US7919101
HIP805	EALAKAAEALAKAAEALAKAAEALAKAAWASLWNWF	36	Synthetic	NA	Fusion inhibitor	CD spectra	US7919101



« previous12345678910next »

 CSIR-Institute of Microbial Technology, Chandigarh 160036, India