Database of HIV inhibiting peptides
| HIPid | HIP1016 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFRS |
| Length | 48 |
| Nomenclature | - |
| Source | gp41 |
| Cell line | PM-1 |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Virus entry |
| Assay | Flow cytometry |
| Properties | View |
| Structure | Jmol |
| Paper | Efficient entry inhibition of human and nonhuman primate immunodeficiency virus by cell surface-expressed gp41-derived peptides. |
| Authors | Zahn RC, Hermann FG, Kim EY, Rett MD, Wolinsky SM, Johnson RP, Villinger F, von Laer D, Schmitz JE. |
| Reference | Gene Ther. 2008 Sep;15(17):1210-22. Epub 2008 May 1. |
| Pubmed ID | 18449216 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India