HIPid | HIP1016 |
Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFRS |
Length | 48 |
Nomenclature | - |
Source | gp41 |
Cell line | PM-1 |
Inhibition/IC50 | High |
Unit | NA |
Target | Virus entry |
Assay | Flow cytometry |
Properties | View |
Structure | Jmol |
Paper | Efficient entry inhibition of human and nonhuman primate immunodeficiency virus by cell surface-expressed gp41-derived peptides. |
Authors | Zahn RC, Hermann FG, Kim EY, Rett MD, Wolinsky SM, Johnson RP, Villinger F, von Laer D, Schmitz JE. |
Reference | Gene Ther. 2008 Sep;15(17):1210-22. Epub 2008 May 1. |
Pubmed ID | 18449216 |