Database of HIV inhibiting peptides
| HIPid | HIP1045 |
| Sequence | SQGVVESMNKELKKIIGQVRDQAEHLKTAY |
| Length | 30 |
| Nomenclature | integrase (147-175) |
| Source | Integrase |
| Cell line | NA |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Integrase |
| Assay | Integrase Assay |
| Properties | View |
| Structure | Jmol |
| Paper | A synthetic peptide from the human immunodeficiency virus type-1 integrase exhibits coiled-coil properties and interferes with the in vitro integration activity of the enzyme. Correlated biochemical and spectroscopic results. |
| Authors | Sourgen F, Maroun RG, Frere V, Bouziane M, Auclair C, Troalen F, Fermandjian S. |
| Reference | Eur J Biochem. 1996 Sep 15;240(3):765-73. |
| Pubmed ID | 8856082 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India