| HIPid | HIP1052 |
| Sequence | MAGRSGDSDEELLKTVRLIKFLYQSNPPPS |
| Length | 30 |
| Nomenclature | Rev1-30 |
| Source | rev |
| Cell line | TZM-bl |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Integrase |
| Assay | MAGI Assay |
| Properties | View |
| Structure | Jmol |
| Paper | Interaction between HIV-1 Rev and integrase proteins: a basis for the development of anti-HIV peptides. |
| Authors | Rosenbluh J, Hayouka Z, Loya S, Levin A, Armon-Omer A, Britan E, Hizi A, Kotler M, Friedler A, Loyter A. |
| Reference | J Biol Chem. 2007 May 25;282(21):15743-53. Epub 2007 Apr 2. |
| Pubmed ID | 17403681 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India