HIPid | HIP1052 |
Sequence | MAGRSGDSDEELLKTVRLIKFLYQSNPPPS |
Length | 30 |
Nomenclature | Rev1-30 |
Source | rev |
Cell line | TZM-bl |
Inhibition/IC50 | High |
Unit | NA |
Target | Integrase |
Assay | MAGI Assay |
Properties | View |
Structure | Jmol |
Paper | Interaction between HIV-1 Rev and integrase proteins: a basis for the development of anti-HIV peptides. |
Authors | Rosenbluh J, Hayouka Z, Loya S, Levin A, Armon-Omer A, Britan E, Hizi A, Kotler M, Friedler A, Loyter A. |
Reference | J Biol Chem. 2007 May 25;282(21):15743-53. Epub 2007 Apr 2. |
Pubmed ID | 17403681 |