| HIPid | HIP1087 |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Length | 36 |
| Nomenclature | T20 |
| Source | CCR5 |
| Cell line | MT-4 |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Fusion inhibitor |
| Assay | MTT assay |
| Properties | View |
| Structure | Jmol |
| Paper | Inhibition of HIV-1 infection by synthetic peptides derived CCR5 fragments. |
| Authors | Imai M, Baranyi L, Okada N, Okada H. |
| Reference | Biochem Biophys Res Commun. 2007 Feb 23;353(4):851-6. Epub 2006 Dec 21. |
| Pubmed ID | 17210123 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India