Database of HIV inhibiting peptides
| HIPid | HIP1093 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
| Length | 34 |
| Nomenclature | C34 |
| Source | gp41 |
| Cell line | MT-2 |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Fusion inhibitor |
| Assay | Immunoprecipitation |
| Properties | View |
| Structure | Jmol |
| Paper | Direct evidence that C-peptide inhibitors of human immunodeficiency virus type 1 entry bind to the gp41 N-helical domain in receptor-activated viral envelope. |
| Authors | Kilgore NR, Salzwedel K, Reddick M, Allaway GP, Wild CT. |
| Reference | J Virol. 2003 Jul;77(13):7669-72. |
| Pubmed ID | 12805467 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India