Database of HIV inhibiting peptides
| HIPid | HIP1103 |
| Sequence | WMEWEREIDNYTSEIYTLIEESQNQQEKNEQELL |
| Length | 34 |
| Nomenclature | C34 |
| Source | gp41 |
| Cell line | TZM-bl |
| Inhibition/IC50 | High |
| Unit | NA |
| Target | Fusion inhibitor |
| Assay | Fluorescence anisotropy |
| Properties | View |
| Structure | Jmol |
| Paper | Early steps of HIV-1 fusion define the sensitivity to inhibitory peptides that block 6-helix bundle formation. |
| Authors | Miyauchi K, Kozlov MM, Melikyan GB. |
| Reference | PLoS Pathog. 2009 Sep;5(9):e1000585. Epub 2009 Sep 18. |
| Pubmed ID | 19763181 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India