Database of HIV inhibiting peptides
| HIPid | HIP1117 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
| Length | 34 |
| Nomenclature | C34 |
| Source | gp41 |
| Cell line | TZM-bl |
| Inhibition/IC50 | 16.83 |
| Unit | nM |
| Target | Fusion inhibitor |
| Assay | Pseudovirus assay |
| Properties | View |
| Structure | Jmol |
| Paper | A multi-functional peptide as an HIV-1 entry inhibitor based on self-concentration, recognition, and covalent attachment. |
| Authors | Zhao L, Tong P, Chen YX, Hu ZW, Wang K, Zhang YN, Zhao DS, Cai LF, Liu KL, Zhao YF, Li YM. |
| Reference | Org Biomol Chem. 2012 Aug 28;10(32):6512-20. Epub 2012 Jul 4. |
| Pubmed ID | 22760295 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India