| HIPid | HIP1118 |
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Length | 36 |
| Nomenclature | T20 |
| Source | gp41 |
| Cell line | 293T |
| Inhibition/IC50 | 222 |
| Unit | nM |
| Target | Fusion inhibitor |
| Assay | Pseudovirus assay |
| Properties | View |
| Structure | Jmol |
| Paper | Trimeric, coiled-coil extension on peptide fusion inhibitor of HIV-1 influences selection of resistance pathways. |
| Authors | Zhuang M, Wang W, De Feo CJ, Vassell R, Weiss CD. |
| Reference | J Biol Chem. 2012 Mar 9;287(11):8297-309. Epub 2012 Jan 10. |
| Pubmed ID | 22235115 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India