| HIPid | HIP1124 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
| Length | 34 |
| Nomenclature | C34 |
| Source | gp41 |
| Cell line | NA |
| Inhibition/IC50 | 0.68 |
| Unit | nM |
| Target | Fusion inhibitor |
| Assay | MAGI Assay |
| Properties | View |
| Structure | Jmol |
| Paper | Remodeling of gp41-C34 peptide leads to highly effective inhibitors of the fusion of HIV-1 with target cells. |
| Authors | Otaka A, Nakamura M, Nameki D, Kodama E, Uchiyama S, Nakamura S, Nakano H, Tamamura H, Kobayashi Y, Matsuoka M, Fujii N. |
| Reference | Angew Chem Int Ed Engl. 2002 Aug 16;41(16):2937-40. No abstract available. |
| Pubmed ID | 12203417 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India