| |
HIPid | HIP1132 |
Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIK |
Length | 56 |
Nomenclature | P5 |
Source | gp41 |
Cell line | HeLa |
Inhibition/IC50 | 60 |
Unit |
nM |
Target | Fusion inhibitor |
Assay | Cell-to-cell fusion assay |
Properties | View |
Structure | Jmol |
Paper | Peptide P5 (residues 628-683), comprising the entire membrane proximal region of HIV-1 gp41 and its calcium-binding site, is a potent inhibitor of HIV-1 infection. |
Authors | Yu H, Tudor D, Alfsen A, Labrosse B, Clavel F, Bomsel M. |
Reference | Retrovirology. 2008 Oct 16;5:93. |
Pubmed ID | 18925934 |