| |
|---|
| HIPid | HIP1132 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIK |
| Length | 56 |
| Nomenclature | P5 |
| Source | gp41 |
| Cell line | HeLa |
| Inhibition/IC50 | 60 |
| Unit |
nM |
| Target | Fusion inhibitor |
| Assay | Cell-to-cell fusion assay |
| Properties | View |
| Structure | Jmol |
| Paper | Peptide P5 (residues 628-683), comprising the entire membrane proximal region of HIV-1 gp41 and its calcium-binding site, is a potent inhibitor of HIV-1 infection. |
| Authors | Yu H, Tudor D, Alfsen A, Labrosse B, Clavel F, Bomsel M. |
| Reference | Retrovirology. 2008 Oct 16;5:93. |
| Pubmed ID | 18925934 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India