| HIPid | HIP1174 |
| Sequence | IKKTYEEIKKTYEEIKKTYEEIKKTYEEIERDWEMV |
| Length | 36 |
| Nomenclature | 4HR-LBD |
| Source | Synthetic |
| Cell line | H9/HIV-1I |
| Inhibition/IC50 | 117 |
| Unit | μM |
| Target | Fusion inhibitor |
| Assay | ELISA |
| Properties | View |
| Structure | Jmol |
| Paper | Rationally designed anti-HIV peptides containing multifunctional domains as molecule probes for studying the mechanisms of action of the first and second generation HIV fusion inhibitors. |
| Authors | Qi Z, Shi W, Xue N, Pan C, Jing W, Liu K, Jiang S. |
| Reference | J Biol Chem. 2008 Oct 31;283(44):30376-84. Epub 2008 Jul 28. |
| Pubmed ID | 18662985 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India