Database of HIV inhibiting peptides
| HIPid | HIP777 |
| Sequence | QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL |
| Length | 33 |
| Nomenclature | I33 |
| Source | Synthetic |
| Cell line | HeLa |
| Inhibition/IC50 | 9 |
| Unit | μM |
| Target | Integrase |
| Assay | Disintegration assay |
| Properties | View |
| Structure | Jmol |
| Paper | A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase. |
| Authors | de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B. |
| Reference | J Mol Biol. 2002 Apr 19;318(1):45-58. |
| Pubmed ID | 12054767 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India