HIPid | HIP777 |
Sequence | QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL |
Length | 33 |
Nomenclature | I33 |
Source | Synthetic |
Cell line | HeLa |
Inhibition/IC50 | 9 |
Unit | μM |
Target | Integrase |
Assay | Disintegration assay |
Properties | View |
Structure | Jmol |
Paper | A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase. |
Authors | de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B. |
Reference | J Mol Biol. 2002 Apr 19;318(1):45-58. |
Pubmed ID | 12054767 |