| HIPid | HIP787 |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
| Length | 34 |
| Nomenclature | C34 |
| Source | C34 |
| Cell line | HeLa |
| Inhibition/IC50 | 7.3±2.5 |
| Unit | nM(fold) |
| Target | Fusion inhibitor |
| Assay | MAGI assay |
| Properties | View |
| Structure | Jmol |
| Paper | Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20. |
| Authors | Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M. |
| Reference | J Biol Chem. 2009 Feb 20;284(8):4914-20. Epub 2008 Dec 10. |
| Pubmed ID | 19073606 |
CSIR-Institute of Microbial Technology, Chandigarh 160036, India